(data stored in ACNUC7421 zone)

EMBL: CP001402.PE454

CP001402.PE454       Location/Qualifiers
FT   CDS_pept        complement(391801..394467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41090"
FT                   /db_xref="GOA:C4KDW7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW7"
FT                   /protein_id="ACR41090.1"
FT                   /translation="MYSVLSIKDKKIISLLILVATAISPIFAIAQSASSSPASTAITII
FT                   SYNGNDANGILAFEHGQIAFYAYAVPPSEYTSLPPGAKAYLLPSTYYDILVNPLNTTFG
FT                   FNPFQFQEVRFALNYIVNRTYFVDSILHGYGIPTISLYAGEPDVIHLQQTLSKYANVHY
FT                   NFTYANETIYKVLTAHGAKYINGQWYYNGKPITVYVFVRTDATVRREYAQYFITQLQKL
FT                   GFTVQQIQGNLQKEISVVYGSDPANTTWNILVEAWGGTYGYYDSGLAVGLYSTLGASDP
FT                   FSSYYGLSMGTYNDTKYESSLLLKEANELDNLSLIISQSQFTSAQEYYQIYNKIVELGI
FT                   NMSVRIGLGMSLTPIYALSNINGVYPSFAQSTLLSFQTYYSITNGSYPNVTIGVRYLSQ
FT                   GSANPGAGFTDAYTDEIGNALFTPSSLTVPGSGYPVPFIYTYKIVNITPHAVVSVPSNA
FT                   LWWNPTTQQITKVSPNTTAQMAVIYNLAPLFNNDKWADGQNITLADIIYEYIVASEMSL
FT                   NSSNPIYDSTASSVYAPALQTIKGFKIINSTAIEIWGNDWFFDPTEAVVSLFGSFNPLG
FT                   YALAGGGYFPWQMYVGMKDVVAQGKAAWSEGAAQSKGIDWLNLVSPTDIGYITSALQNA
FT                   SATGYIPKSLQIVENLSGITLVTPQEAKAGYEAAINFMKTYGNGLIGDGPYILVAWNPS
FT                   ASPPYAKLIRNPYFHLVPPSNALALPTMYSVSLSIPSTVSLGQTLTGTVMGTPAGSTTA
FT                   IPTPNAVVNIELLYPNGSIISGYQLMTNSSGQFTFTVPSSLSPGSYLLSVSAYSNTSIL
FT                   INPVTYTLVVLPSITTTTSTTTSTTTTTSVSTSLSTTTITSVSTVVSSASNIGYIAVIV
FT                   VLIIIIIALAVLLFRRR"
     gtgtatagtg tgttaagtat aaaagacaaa aaaataattt cgctcttaat actagttgca        60
     actgctatca gtcccatttt tgccatagca caatctgcca gttcctcgcc tgcttctaca       120
     gcaataacaa taatttcata taacggtaat gacgcaaacg gtatattggc ttttgagcat       180
     gggcaaatag ccttttatgc ttacgctgta cctccatcag aatatacaag tttgcctcca       240
     ggggctaaag cttacttact accgagtact tattatgaca ttctggtaaa tccattaaat       300
     actacttttg gttttaaccc attccaattc caagaagtta gattcgcact gaactatata       360
     gtaaatagaa cctattttgt agatagtata ctacacggtt atggtatacc aactatatct       420
     ctatatgctg gagaacctga tgtgattcat ctccaacaaa cactatctaa gtacgctaat       480
     gttcactata atttcactta tgcaaatgaa accatttata aagttctaac tgctcatggt       540
     gctaaatata ttaatggaca atggtattat aatgggaaac ccataacagt ttacgtattt       600
     gtcagaactg atgccactgt aaggagagaa tatgcccaat actttataac tcaactacag       660
     aagttaggtt ttactgtcca gcaaattcaa gggaatttac aaaaggaaat ttctgtagta       720
     tacggtagcg atcctgcaaa tactacgtgg aatatattag ttgaagcttg gggtgggact       780
     tatggatatt atgattctgg tttagcagta ggtctttaca gtactttagg ggcttctgat       840
     ccattttctt catattacgg cttaagtatg ggtacgtata acgataccaa gtatgaatcc       900
     tcattattac ttaaagaggc taatgagctt gacaatctat cattgataat atcccaaagt       960
     cagttcacta gcgcccaaga atattaccaa atatataata agattgtaga gctaggtatt      1020
     aacatgtcag taagaatagg actaggaatg agtctaaccc caatatacgc actatctaac      1080
     attaatggtg tgtatccaag ttttgcccaa agtacactac taagcttcca gacatattat      1140
     tctataacga atggaagcta tcctaatgtt acaataggtg ttagatactt aagccaaggt      1200
     tcggctaatc caggtgctgg tttcactgat gcctatacag atgaaatagg aaacgcttta      1260
     ttcactccgt cctctttaac agtaccaggt tcgggatacc cagtaccttt catttatact      1320
     tacaagatag ttaatataac tccacatgct gtagtatcag taccttcaaa tgcattgtgg      1380
     tggaatccaa ctacgcagca aataactaag gtatctccta atactactgc gcaaatggct      1440
     gtaatatata acttagcccc actgttcaat aacgataaat gggctgatgg tcaaaatata      1500
     actcttgctg acataatata tgaatatatt gttgcatccg agatgtcctt aaactctagt      1560
     aatccaattt atgactcaac tgcatcatca gtatatgctc cagcactaca gactattaaa      1620
     ggatttaaga taattaactc cactgctata gaaatatggg gcaatgattg gttcttcgat      1680
     cctactgagg ctgtagttag cttatttgga tctttcaatc cattaggtta cgcgttagct      1740
     ggcggaggtt atttcccatg gcaaatgtat gttggtatga aagatgttgt tgcacaaggt      1800
     aaagctgcgt ggtctgaggg agcagctcag tccaaaggaa ttgattggct gaatctagtt      1860
     agtccaactg atattggata tataacttca gcgttacaga atgcctcagc tactggatat      1920
     atacctaaga gtttacagat agtagagaac ttaagcggta taactctagt aactccacaa      1980
     gaagcaaaag ctggatatga agcggcaatt aacttcatga agacctatgg aaatggatta      2040
     ataggtgatg gtccatatat cttggtagcg tggaatccga gtgcgtctcc accctacgca      2100
     aaactgataa ggaatcccta cttccatttg gttcctccat ctaatgcgtt agccttaccg      2160
     actatgtatt cagtttcact aagcatccca tcaacagttt cacttggtca aaccttaact      2220
     ggtactgtaa tgggaactcc tgctggaagt accacagcaa tacctactcc aaatgccgtg      2280
     gttaatatag aattattgta tccaaatggc tctataatat caggatatca attaatgacc      2340
     aattctagtg gacaatttac cttcaccgtt ccatcttcat tatctcctgg atcataccta      2400
     ctatcggtat cagcgtacag taatacttca atattaataa atccagtaac atatactctt      2460
     gtagtattac catccataac aactactacg agcacaacaa caagtactac tacgactaca      2520
     tcagtcagta cgtctttatc cacaactacg attacttcag tcagtactgt agtatctagt      2580
     gcctcgaata ttggctatat tgctgtaata gtagtcctaa taattataat aatagcttta      2640
     gcggtattat tattcagaag gagataa                                          2667
//

If you have problems or comments...

PBIL Back to PBIL home page