(data stored in ACNUC7421 zone)

EMBL: CP001402.PE455

CP001402.PE455       Location/Qualifiers
FT   CDS_pept        complement(394528..395535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0461"
FT                   /product="protein of unknown function DUF871"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41091"
FT                   /db_xref="GOA:C4KDW8"
FT                   /db_xref="InterPro:IPR008589"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW8"
FT                   /protein_id="ACR41091.1"
FT                   /translation="MTKRRIGFSIFPGWKEIKDEQISLLKNVRDLGFSEIFMGIGPGTH
FT                   WRTPVNEALSVAKEILKEANKLHYYAFVDINPQILKELNASPRNLSMFMEIGFKGVRAD
FT                   YGFSKEEIVEMSKQMTVELNPFEISEEEVDFIARNSNLERIKACHNYYPVLYSGISKEI
FT                   FIEKNRIFKERGIEIGAFISNPKFNLRTTLEVLRYVEPFDSANYLFKFVDRVLIGDPIP
FT                   DYESLRQVSEVFKSDITKIRIKVYDESVGKRLDKKFAVENYREFAIVCYTRDNIYEGET
FT                   CYTKLFKNAVAVRGREVWIFTSDLGIGPYRLVGEIDDINMEIVKMSSEIMLISK"
     atgactaaga gaagaattgg tttctcaatc ttcccaggtt ggaaggagat aaaagatgag        60
     caaattagtt tattgaaaaa tgttagagat ctgggatttt ccgaaatatt catgggaatt       120
     ggtcccggaa cccattggag gactccggta aatgaggcgc ttagtgttgc caaggagatc       180
     ttaaaagagg ctaacaaatt gcactattat gcctttgtgg atataaaccc gcaaattctt       240
     aaagagttga acgcatctcc taggaattta tcaatgttta tggaaattgg ctttaaggga       300
     gttagggctg actacggatt tagtaaagag gaaatcgttg aaatgagtaa gcaaatgact       360
     gttgagctaa acccatttga gataagcgag gaagaggtag actttattgc cagaaattca       420
     aatcttgaaa ggattaaggc ttgccacaac tattacccag tcttgtatag tgggatatct       480
     aaagagatct ttatagagaa gaataggata tttaaggaaa gaggtataga gatcggtgcg       540
     tttatctcta atccaaagtt taatctcaga accacattag aggttttaag gtatgtagaa       600
     ccattcgatt ctgccaatta cttgttcaaa ttcgtcgaca gagttttgat aggagacccc       660
     attccagatt atgaaagttt aaggcaagta tcggaagttt tcaagtctga tattactaag       720
     ataagaatta aagtatatga tgaaagcgtg ggcaaaagat tagataaaaa gtttgcagtg       780
     gaaaattata gggagttcgc catagtgtgt tatactaggg ataatatata tgaaggtgaa       840
     acgtgttata ctaaattatt taaaaatgcg gtggcagtga ggggcagaga agtatggata       900
     ttcactagtg atttgggaat tggtccctac aggttagtag gggaaataga tgatattaat       960
     atggaaattg tcaaaatgtc gagtgagatc atgttaatta gtaaataa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page