(data stored in ACNUC7421 zone)

EMBL: CP001402.PE456

CP001402.PE456       Location/Qualifiers
FT   CDS_pept        395571..396023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0462"
FT                   /product="alanyl-tRNA synthetase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41092"
FT                   /db_xref="GOA:C4KDW9"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW9"
FT                   /protein_id="ACR41092.1"
FT                   /translation="MDQVEIRTHTALHVVKGAVRKVLGAKWTASTYVNSNHGRLTVKFE
FT                   RKPSDEEMDKVFELANEKVRKNLPIIIEVLPREEAERKYGDEIYDLFLIPAEVRELSIV
FT                   VIPDWNINACNKQHTKTTSEIGEIIKDYWRYRNSKQLLEMSFDIKC"
     atggatcaag ttgagattcg cactcacacc gccttacatg tggttaaagg agctgtgagg        60
     aaagttttgg gtgccaaatg gactgcaagc acttacgtta atagcaatca tggaagatta       120
     acggtaaagt ttgagaggaa acctagcgat gaggaaatgg ataaggtctt tgaattggct       180
     aacgagaagg ttagaaaaaa ccttccaata ataattgagg ttttacctag ggaagaagct       240
     gaaaggaaat atggagatga gatctacgat ctctttctta ttccagctga ggttagggag       300
     ttaagcattg tggtaatacc agattggaat attaacgctt gcaataagca acatactaag       360
     actacctctg agattggaga gatcatcaag gactattgga gatataggaa tagtaaacag       420
     ttactcgaga tgtcatttga cataaagtgt taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page