(data stored in ACNUC7421 zone)

EMBL: CP001402.PE457

CP001402.PE457       Location/Qualifiers
FT   CDS_pept        396026..397411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41093"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX0"
FT                   /protein_id="ACR41093.1"
FT                   /translation="MIGKVLELLNCKETEREINRRKFSVCDDVNFILNLPIGYLKDVIS
FT                   PLENYLSKHMTNNFSRLTRVVPNDYEDTQLHFSKFFLNLYSSAISEIPRFNILTSLVIL
FT                   DEYRMMPDKALIAAADELARNGINAIFSTSTPSVFFEEEIVSRFRNRRVVSISIVNEYG
FT                   QAVEGRDCVKKGEGYYQCRGSYEVIELIEDFNIRDLDYEIIKGVEVFKVKEPFTLFVNS
FT                   WEKALRLYRKLREERNTEVCLLNSSDECKVTITPKIMPTRFNVVSEISSLPTIVARSGI
FT                   INDRDKIYVWVDRDNYDTVTESTLNLLSNIKVCLKHPFGCNGKMGYANKTVLKPNIDER
FT                   LIKRLSEISHLMDRREFEKVTELFSDFVTVDLFTDKEKITTVPPEFVYENKKKILYYGN
FT                   NCVYTYFTDGEKCSKIVYNWLEGGGVSWLKRNLARAYKNYVEEEGKKEVFLGLKAKDVG
FT                   EWI"
     atgataggaa aagtccttga gcttttaaac tgtaaggaga ctgagaggga aattaacaga        60
     agaaaatttt cagtatgcga tgatgttaac ttcatcttga atttacccat cggttattta       120
     aaagatgtaa tttcaccact tgaaaactat ttatcaaaac atatgactaa taacttttca       180
     agactaactc gcgtagttcc taacgattat gaggatactc aactacattt cagtaaattc       240
     tttttaaacc tttacagtag cgcaatttct gaaatcccaa gatttaacat ccttacctca       300
     ctagtcatct tagatgagta tcgaatgatg ccagataagg ctttaattgc tgcagctgac       360
     gaattggcga ggaatggcat taacgcaatt ttctctactt caacaccttc ggtattcttt       420
     gaggaggaga tagtaagtag atttagaaat agaagagtgg tatctatttc aatagttaat       480
     gaatatgggc aagcggttga gggtagggat tgcgtgaaga aaggtgaggg atattatcag       540
     tgtagaggta gttacgaagt gattgaatta attgaggatt ttaacattag ggatttagat       600
     tatgagatca ttaaaggtgt agaggtattt aaggtaaagg aaccatttac gcttttcgta       660
     aattcttggg aaaaggcgtt gagattatac agaaagttaa gggaggaaag aaatactgag       720
     gtatgtttac ttaatagtag tgatgaatgc aaagtgacta ttacacctaa aattatgcct       780
     actaggttta acgtggtgag cgaaatttca tcattaccaa ctattgtagc tagaagtgga       840
     attattaacg atagggataa gatctacgtc tgggttgata gggataatta cgatacagtg       900
     actgaaagta ctcttaatct actttcaaat atcaaagtat gcttaaaaca tccctttggc       960
     tgtaatggaa agatgggata tgctaacaag acggtcttaa agcctaacat tgatgaaagg      1020
     cttataaaaa ggctaagtga aataagccac ttaatggata gaagggagtt cgagaaggtg      1080
     acagaactct tcagtgattt cgtaacagtc gatctattta ctgataaaga gaaaataact      1140
     acagtacctc ccgagtttgt atacgagaac aaaaagaaga tattatacta cgggaataac      1200
     tgcgtttaca cgtactttac tgatggagaa aaatgctcta agatagttta taattggtta      1260
     gaaggcggag gtgtttcatg gcttaagagg aatttagcaa gggcttataa gaattacgtt      1320
     gaggaagaag gaaaaaagga ggtatttttg ggattaaagg ctaaagacgt gggagaatgg      1380
     atttag                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page