(data stored in ACNUC7421 zone)

EMBL: CP001402.PE458

CP001402.PE458       Location/Qualifiers
FT   CDS_pept        397402..397893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41094"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX1"
FT                   /protein_id="ACR41094.1"
FT                   /translation="MDLEKFRREYYYVVPIIANRIKRDEEKVKKYIELAIILQSAIGNE
FT                   VYTAYYLYYIYEELGDIDLGIPIVLAIVNHRDVWKARALRSVTAYNTLKVFEVKDDVKR
FT                   IIENKLREINIPMEIVMKILNNVEPIQIRKLFSNLSIVHPEVYSLILGVFTSIEQGNEG
FT                   "
     atggatttag agaagtttag gagagagtat tattacgttg tccccataat cgccaatagg        60
     attaagagag atgaggagaa agttaaaaag tacattgagc ttgccataat cttacagagc       120
     gcaataggaa atgaagtata tactgcatat tatctttact acatatacga ggaactgggt       180
     gatattgatc taggaattcc gatcgttttg gcaattgtta accatagaga tgtatggaag       240
     gctagagctc tcagaagtgt tacagcgtat aatacgttaa aggtatttga ggttaaagat       300
     gatgtaaaga gaataattga aaataagtta agggaaatta acattccaat ggaaatcgtt       360
     atgaaaatat taaataatgt tgaaccaata cagattagaa aactattcag caatttgtct       420
     atagttcacc cagaagtgta tagtctgatt ttaggtgtat ttacctcgat tgagcaggga       480
     aatgagggtt ag                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page