(data stored in ACNUC7421 zone)

EMBL: CP001402.PE461

CP001402.PE461       Location/Qualifiers
FT   CDS_pept        400544..401281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41097"
FT                   /db_xref="GOA:C4KDX4"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX4"
FT                   /protein_id="ACR41097.1"
FT                   /translation="MMRSRSFQIFRVIFKERYRQPTLELVIPTMLVSNIFITAFYARGL
FT                   FNTYGLVLAFIPLISVSETLAFALALRNIIFVTGDHIYRGSIISFIMIPIKRISLFFFT
FT                   YFCDIVLPYLFWLFTTELYILLSGIPVPQYLILVYTVCYFFTENIILLTALSFKSGGIV
FT                   TLLSGTILGILFIFGGIAGYYGIMTNSPLTPIATISNPYVFLIYEAISQKQVTYLNVGI
FT                   YSEVIISLILFFVSLQKFRIMEV"
     atgatgcgtt caagaagttt tcaaatattt agagttatat tcaaggagag atatcgacaa        60
     ccaactcttg agttagttat accaacaatg ttagtttcaa acatcttcat tactgcattt       120
     tacgctaggg gattatttaa cacttatggt ttagtactag cattcatacc tttaataagc       180
     gtttcagaaa ccctagcctt tgccttagct ttgaggaata tcattttcgt tactggggat       240
     cacatttata ggggttccat catatccttc ataatgatac ctataaagag aattagcttg       300
     ttcttcttca catatttttg cgatatcgta ttaccatatt tattttggtt attcacaacc       360
     gaactttaca ttttgctttc tggaattcca gttcctcaat acttaattct ggtctacact       420
     gtttgttact tctttactga aaatattata cttttaacgg ccctctcatt taagagtgga       480
     ggaatagtga ccctcctatc cgggacaatc ttgggaatct tattcatctt tggaggtatt       540
     gcgggatatt atggaataat gacaaactca ccactgacac caatagcaac tatttcgaat       600
     ccatacgtgt ttttaattta tgaagcaata agccaaaaac aggtaactta cttgaacgtt       660
     ggaatttata gtgaggttat aatatcattg atacttttct tcgtttcatt acaaaaattc       720
     aggataatgg aggtataa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page