(data stored in ACNUC7421 zone)

EMBL: CP001402.PE462

CP001402.PE462       Location/Qualifiers
FT   CDS_pept        401286..401834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41098"
FT                   /db_xref="GOA:C4KDX5"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX5"
FT                   /protein_id="ACR41098.1"
FT                   /translation="MKFGLLTTIGLSLLVLSLLSINSPIHSYVSISNPYSIKIPNIAYV
FT                   NARLLENNSNVTVYAKLVHNGNVENIVKLPYYLELTPGIWEFSIYNETFPITLTKVINA
FT                   TVVNKSNGIVYVYEYQKIEKYQEIVTTKNATYPIALEVTIYKVNILQYKTIAEILGVLL
FT                   LFIDIILLAFRFIRDNHKL"
     atgaaattcg gacttcttac caccataggt ttatccctat tagttctatc cctattatcc        60
     attaactcac caattcactc atacgtaagc atttcaaacc catattccat taaaatacct       120
     aatatagcat atgttaatgc taggcttctc gagaacaaca gtaatgtcac agtttacgcc       180
     aagctcgttc acaatggaaa cgtagaaaat attgttaaat taccttatta tttagaattg       240
     acgccaggga tatgggagtt ctccatatat aacgagacgt ttccaataac tttaacaaaa       300
     gtgataaacg ccactgttgt taataagtca aacggtatag tatacgttta tgaatatcaa       360
     aaaatagaga aatatcaaga aatagttaca actaaaaatg ccacctatcc tattgctctc       420
     gaagtgacaa tatacaaggt taacatactt caatacaaga caatagcgga aatccttggc       480
     gtactcctat tattcattga tattatcttg ttggctttta ggtttattag agataatcat       540
     aaattatag                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page