(data stored in ACNUC7421 zone)

EMBL: CP001402.PE463

CP001402.PE463       Location/Qualifiers
FT   CDS_pept        401854..402381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41099"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX6"
FT                   /protein_id="ACR41099.1"
FT                   /translation="MIISIAAHSEEPNSELAEKARKFVRSIKACNPMLLLGGYWGLMRV
FT                   VVDEALKENMKTVLILPIERENVIIPRDVISIKSSCEFRCRSVILVRSGDILVSLGGGV
FT                   GTEIEIMIAYAMGKPIFALSNTGLSTDQFAKAFPEYIDDRKVIKIRYFEDPEEMAKEIC
FT                   KIEMKSVKTTFG"
     atgatcattt ccatagcagc ccatagtgaa gaaccaaatt ccgagctagc cgaaaaggct        60
     agaaagttcg taaggtcaat taaagcatgt aatccaatgc tgcttttagg aggatattgg       120
     ggattaatga gagtggtagt tgatgaggcg ttaaaagaga acatgaaaac tgtcttgata       180
     ttacccattg agagggaaaa tgttataatt cctagagacg taatttcaat aaaatctagt       240
     tgtgagttta gatgcagatc cgtaatcctt gttaggtctg gtgatatact agtttcattg       300
     ggaggaggtg ttggaacgga aatagaaata atgattgctt acgcaatggg aaagccaata       360
     tttgcattat ctaatacggg gttgagcact gaccaattcg ctaaggcatt tccagaatat       420
     attgacgata gaaaagtcat taagataagg tattttgagg atccagagga gatggctaag       480
     gagatttgca agattgagat gaaaagtgtg aagactactt tcggctaa                    528
//

If you have problems or comments...

PBIL Back to PBIL home page