(data stored in ACNUC7421 zone)

EMBL: CP001402.PE465

CP001402.PE465       Location/Qualifiers
FT   CDS_pept        403420..403722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0471"
FT                   /product="SAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41101"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX8"
FT                   /protein_id="ACR41101.1"
FT                   /translation="MPHFLIHNKNDNVGVAITDIKAGEEVEGVYIEDMAKGPKIKAINN
FT                   IPLGHKIALSNLKQGDTVIKYGRPIGSAIKEIKIGEHVHVHNIRSNRWGKWRKSQ"
     atgccacatt tcctgattca taacaaaaac gacaacgttg gagttgccat aactgacatt        60
     aaagctgggg aagaggtgga aggagtatac attgaggaca tggcaaaagg acctaagatt       120
     aaggcaatta acaacatacc cttagggcat aagatagcct taagtaatct taagcaaggt       180
     gatacagtga taaagtacgg taggccaata ggatctgcta taaaggagat taagattgga       240
     gaacacgtac acgtacataa tataagatct aacaggtggg gaaaatggag aaaaagccag       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page