(data stored in ACNUC7421 zone)

EMBL: CP001402.PE466

CP001402.PE466       Location/Qualifiers
FT   CDS_pept        403704..404870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0472"
FT                   /product="D-galactarate dehydratase/Altronate hydrolase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41102"
FT                   /db_xref="GOA:C4KDX9"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX9"
FT                   /protein_id="ACR41102.1"
FT                   /translation="MEKKPVIKGYIRENGSVGVRNYVTVIPVDDLSNSAAIGVSKLIRG
FT                   TVAIPHPYGRLQFGKDLDLLFHVLSGTGANPNVAGAIVIGIEENWANKVANKIAETGKP
FT                   VEVFPIEGNGDLRVIEKASRKAKEMVQEASEKQRTEVDLSSLVMSIKCGESDTTSGLAS
FT                   NPATGYAVDKLIDYGATVLFGETSELTGAEDIVASRIPDPVLREKFMKIYKEYVDFIES
FT                   QGVDLLGSQPTEGNIKGGLSTIEEKALGNIQKLGTKPITCVLDYLDPLEKNSSRLCFVN
FT                   TSSAAAEAVTLFAAKGSVLHLFTTGQGNVVGHPIIPVVKISANPKTVATMSEHIDVDVS
FT                   DLLQLKVSLREAGERIFNYTIRVANGRLTSAELLQHNEFSPIKLYISA"
     atggagaaaa agccagtaat aaagggttac attagggaaa atggtagcgt tggagttaga        60
     aattacgtaa ccgtaatacc ggtagatgac ctatctaatt ccgctgcaat aggagtatcg       120
     aaactaatta ggggtactgt tgcaattcct catccatatg gtaggttaca atttggtaaa       180
     gacttagatt tactcttcca cgttctatct gggactggtg caaacccaaa cgtagctgga       240
     gcaatagtta ttgggattga ggagaactgg gcaaataagg tagctaataa aatagctgag       300
     actggaaaac cagtcgaggt ttttcctatt gagggaaatg gcgatttgag agtaattgaa       360
     aaggcgagta gaaaggcaaa agagatggtt caagaggcta gtgagaaaca gaggacagaa       420
     gttgatctat cctctttagt tatgagtatt aagtgtgggg agagcgatac tacgtctggt       480
     ttggcatcaa atccagcaac tgggtatgct gttgataagc tgattgatta cggtgcaaca       540
     gtattattcg gagaaacgtc cgagttaact ggtgctgagg acatagttgc aagtaggata       600
     ccggatccag tgttaagaga gaagttcatg aagatttaca aggaatatgt ggatttcatt       660
     gaaagtcaag gagtcgattt attgggttct caaccaactg aggggaacat taagggagga       720
     ttgtcgacaa tagaggaaaa agctttagga aatatacaaa agttgggtac taaacctata       780
     acttgcgtgc tagattattt agacccatta gaaaagaatt cgtctagact atgtttcgtt       840
     aatacctcat ctgctgcagc agaggcagtt acattgtttg ccgccaaggg ttctgtactt       900
     cacttgttca ctactggtca agggaatgtt gttgggcatc caataattcc cgttgttaag       960
     atttcggcaa atccaaagac tgttgcgaca atgagtgagc atattgacgt tgacgtttct      1020
     gacttacttc aactaaaggt tagtttaagg gaagctgggg agaggatatt caactatacg      1080
     attagggttg caaatggtag attaacttca gctgagctat tacaacacaa tgagttctca      1140
     ccaataaagc tttacataag tgcttga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page