(data stored in ACNUC7421 zone)

EMBL: CP001402.PE467

CP001402.PE467       Location/Qualifiers
FT   CDS_pept        404873..406003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0473"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41103"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDY0"
FT                   /protein_id="ACR41103.1"
FT                   /translation="MKVKPFSLSIPFNTNPPSDWKDTWDVQLYVKVEDEEDYGWGETLV
FT                   AGSGIINSYLSIINDIVIPVLSKVELTEPTDVRTILEKILFSAGNCGVVSGAISAVEMA
FT                   LWGLKARKSNVELTRVIGGKVRDSVKVYASFPRFGKIDYIIIATRKSIERGFDLVKLHQ
FT                   SPSSVIDAVKAIRENYKEIKIAIDLNSPFDNLDKAKEFVDKVHKYEIEWVEEPLWPPND
FT                   YDLLSKLTEFSPIPIAAGENEYSLYGFKKLIESGITYLQPDIAKIGGVSKFLEILDLAS
FT                   KHKVRVLPHDRPDASPLSLIYTLNLGLVKSQIEMVEYTIADFPNDLFYSLPKFKNGYIY
FT                   PSENPEVIEENIEKYGYKNRLRILHFSDLESKLTRK"
     atgaaggtaa aacctttttc tttatctata ccctttaata ctaatcctcc ctctgattgg        60
     aaggatacgt gggatgtgca actctacgtt aaagttgaag atgaagaaga ttacggttgg       120
     ggagaaacat tagtagcggg aagcggaatt ataaactctt acctttccat tataaatgat       180
     atagtaatac cagttttgtc taaagtagaa ttaaccgaac caacagacgt taggactatt       240
     ttagagaaga ttctttttag tgctggaaat tgcggagtgg tttccggtgc cataagcgct       300
     gtggaaatgg cattatgggg tttaaaagct aggaaaagta atgtggaatt gactagagta       360
     attggtggta aagttagaga ttcagtaaaa gtatacgcta gttttcccag atttggtaaa       420
     attgattata ttattattgc aactagaaaa tctatagaga gaggttttga tttagttaag       480
     cttcatcaat ctccttcaag tgttatagat gcggttaaag ctataagaga gaattacaag       540
     gaaattaaaa tagcgattga ccttaattct ccttttgata atctagataa ggctaaggag       600
     ttcgtggaca aggttcataa gtatgagatt gaatgggtag aggaaccatt atggcctcct       660
     aatgattacg atttactttc caagcttact gaattttctc ccatacctat tgcagccgga       720
     gagaacgaat actccttata cggttttaag aaattgattg aaagtggtat aacgtatcta       780
     caaccagata ttgctaagat tggaggggta agtaaatttc tagaaatatt agatttggca       840
     tcaaaacata aggtgagagt attgcctcac gataggcctg acgcttctcc actgtccttg       900
     atatacacgt taaatctcgg actagtaaag agccaaatag aaatggtgga gtatacaatt       960
     gcggactttc ccaacgacct attttactcc ttgccaaaat tcaaaaatgg ctatatatat      1020
     ccctcagaga accctgaagt tatagaggaa aacatagaaa aatatggtta taaaaatagg      1080
     ctcagaatat tacatttcag tgatctagaa agtaagctaa caaggaaata a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page