(data stored in ACNUC7421 zone)

EMBL: CP001402.PE47

CP001402.PE47        Location/Qualifiers
FT   CDS_pept        complement(39904..40770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0047"
FT                   /product="protein of unknown function DUF191"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40683"
FT                   /db_xref="GOA:C4KJG3"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJG3"
FT                   /protein_id="ACR40683.1"
FT                   /translation="MVTIRVGALADSGDLYPFIPLMEGKVRPEGFNLEFEVIPTVQDIN
FT                   EAVLKKEVDVSVPSAAMYPYIQDDYYILSNAVATAVDGITGMPILAIKEMSENEIKRSR
FT                   LIVHGPNTTAFTLYKLLMGKYGRLVIIRRVLDEIKALGKEGDVLVAVHEIKMMYALKKL
FT                   GINVVRIGSMWDMWKAISNNTPMPMGMVVISKEVGKDFALKFKETYEKSKKYAEKHLDE
FT                   IIPRDVQIMRESQKADLDEEIVRKTIWADIQEYNVPVDEVRRGLEFFFKISEERGILPR
FT                   VKSIDLL"
     atggtaacaa taagagtagg ggcacttgca gattctggag acctttatcc ttttatacca        60
     ttaatggagg gaaaagttag accagaaggc ttcaacttag agtttgaagt aatacctact       120
     gttcaagata tcaatgaagc ggtattaaag aaagaggtgg atgtttcagt tccatctgct       180
     gcaatgtatc catacataca ggatgactat tacattctaa gtaatgctgt ggcaactgca       240
     gtggatggta taactggtat gccaatttta gcaataaaag aaatgagtga gaacgaaata       300
     aagagaagca ggctaatagt tcatggaccg aacactaccg cgtttacatt atataagcta       360
     cttatgggaa aatatggaag gttagtcata attagaagag tattggacga aataaaagcc       420
     ctgggaaagg agggagatgt gttagtggca gttcatgaaa taaagatgat gtacgctcta       480
     aagaagttgg gaattaatgt agttagaata ggtagcatgt gggatatgtg gaaagctatt       540
     tcaaataata caccaatgcc aatgggcatg gtggtaattt ctaaagaagt tggaaaggac       600
     tttgcactta aatttaaaga gacctacgag aaaagtaaga aatatgcaga gaaacactta       660
     gatgaaataa taccaagaga tgttcaaata atgagagaat cacaaaaagc ggaccttgat       720
     gaagagatag taagaaagac gatctgggct gatatacaag agtacaatgt tccagttgat       780
     gaggtaagaa gaggattaga gttcttcttt aagataagtg aggaaagagg aatattacct       840
     agagtaaaga gtattgactt gctctaa                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page