(data stored in ACNUC7421 zone)

EMBL: CP001402.PE471

CP001402.PE471       Location/Qualifiers
FT   CDS_pept        complement(409281..409709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0479"
FT                   /product="thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41107"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDY4"
FT                   /protein_id="ACR41107.1"
FT                   /translation="MLSASEVNEMLKQEEIFNFIGIKFEKLERGYARLKFNFNEKLTRI
FT                   GGILHGGIIFSAVDYAGSYAVRTLENVKDGVTVELKINFLKPMKDGPFIVEARIISEGK
FT                   RLIVVDISTYDGNGNLCAKALGTWVVYRDTSSGTQLSS"
     atgttatcgg caagcgaagt aaatgagatg cttaaacaag aggaaatttt caattttata        60
     ggaatcaagt ttgaaaaact tgaaagaggt tacgcaaggc taaaattcaa tttcaacgaa       120
     aagttgacta gaataggtgg gattttacac ggtggaataa tattctcagc agttgactat       180
     gcaggtagct acgccgtgag aactttggaa aacgtgaagg atggagtcac agtggaactc       240
     aaaataaact ttttgaagcc aatgaaggat ggtccattta tagtagaagc tagaataata       300
     agtgagggaa aaaggctaat agtagttgac atatcaacat atgatggtaa cggtaattta       360
     tgcgcaaagg ccttaggtac ctgggttgta tatagggata ctagctctgg aactcaatta       420
     tcctcttag                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page