(data stored in ACNUC7421 zone)

EMBL: CP001402.PE473

CP001402.PE473       Location/Qualifiers
FT   CDS_pept        complement(411464..412201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0481"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41109"
FT                   /db_xref="GOA:C4KDY6"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDY6"
FT                   /protein_id="ACR41109.1"
FT                   /translation="MKCKIPFVELPNSFPKSDVDVYRVLEEDGKYYIRLELDGKPMYLT
FT                   FSANEIVLHSKELYEMVSREEIDDCSPLGILDEIFYIILYQLGTKRTQLFLEFDNLFDL
FT                   ITSGKIKDSKRIILLRKRILTNYSDSTVIYYVSRRLSKFLSAESIEDVKFNYERAELLV
FT                   TRSGDLYNIYLTEVQNDLNEIIKKLTSISFIFMPITAIASIYAVDYTNVYNTLINWQSL
FT                   IFLSPVLILTVLLVIYLRRIKWL"
     atgaagtgta agataccttt cgtcgaattg ccaaacagtt ttcccaaatc tgatgtggat        60
     gtttacaggg tattggagga ggatgggaaa tattatatta gacttgaact agatggtaaa       120
     ccaatgtatc taaccttcag tgccaatgaa atagtcttgc actccaagga attgtacgaa       180
     atggtctcaa gggaggagat tgatgattgt tccccgttgg gaattttaga cgaaatcttc       240
     tatattattt tatatcaatt gggtactaag agaactcaac tcttcttaga attcgataac       300
     cttttcgatc tcataacatc tgggaagata aaggactcaa aacgtataat actgttaagg       360
     aaaaggatac taaccaatta ttccgattca acggtaatat actacgttag cagaaggcta       420
     agcaaattcc tctcagctga gagcatagag gacgttaagt ttaattacga aagggccgag       480
     ttgctagtca ccagatctgg tgatttatac aacatctatc tcacagaagt ccaaaacgac       540
     ttaaacgaga taatcaaaaa gcttacttca atatccttta tatttatgcc cataacggca       600
     attgcaagca tttatgcagt tgactacaca aatgtatata atacactcat aaactggcag       660
     agcttgatct ttttatctcc cgttttaata ttaacagttc ttctagtaat ttatttgagg       720
     aggataaaat ggttgtga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page