(data stored in ACNUC7421 zone)

EMBL: CP001402.PE474

CP001402.PE474       Location/Qualifiers
FT   CDS_pept        complement(412198..412461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_2787"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_2787"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41110"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDY7"
FT                   /protein_id="ACR41110.1"
FT                   /translation="MYYRGKVEQLLNKIELVIPYDKVRDVAVKYISSFPKSILENQRLF
FT                   YEKVYVPLRDHFIEKVVNRKRVWRISFISNNALYLKLVRVKI"
     ttgtattacc gaggaaaagt agaacaactg ctaaataaaa ttgaacttgt aataccatat        60
     gataaggtgc gagacgtagc agttaagtac atttcttcat ttccgaaaag catattggag       120
     aatcaaaggt tattttacga gaaagtttac gttccactga gggatcactt tatagaaaaa       180
     gttgtgaata ggaagagggt ttggaggatt tccttcatta gtaacaatgc tttatatcta       240
     aagcttgtaa gggttaaaat atga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page