(data stored in ACNUC7421 zone)

EMBL: CP001402.PE479

CP001402.PE479       Location/Qualifiers
FT   CDS_pept        416017..416292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41115"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ2"
FT                   /protein_id="ACR41115.1"
FT                   /translation="MLSTLDNQLKGLYYVKGKDFEIYFYDEVNSRLLQVTYTSDKIEER
FT                   EIRSLLKAEEMLRAKELIVITYDIEGEEEREGKKIKLIPLYKFLLT"
     atgttgtcga cactcgataa ccaattaaaa ggactgtatt acgttaaagg taaggacttc        60
     gaaatatatt tttatgatga ggttaactca cgtctgctgc aagtgactta cacttcagat       120
     aagatcgaag agagggagat aagatctctt ctaaaggctg aggaaatgtt aagagctaag       180
     gagttaatag tgatcactta cgatattgag ggtgaagagg aaagggaggg taagaagata       240
     aaactcatcc ccttatataa gtttttattg acctga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page