(data stored in ACNUC7421 zone)

EMBL: CP001402.PE48

CP001402.PE48        Location/Qualifiers
FT   CDS_pept        40874..41404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0048"
FT                   /product="protein of unknown function DUF84"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40684"
FT                   /db_xref="GOA:C4KJG4"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KJG4"
FT                   /protein_id="ACR40684.1"
FT                   /translation="MVTIALGSRNPVKINATKEALDVLKLNWDLIGIEVDSGVDKQPFC
FT                   DQTYVGARNRALNVIRVTNADIGLGIEGGVCNVYGKFIANAVVYVITKEGLENFAISSS
FT                   FTLPSSMVSLILQGKELGEASDIIFKTNNSKTKEGAIGLLTNNVINRKMLYVQPIVLAL
FT                   YPIYNTMINNTPF"
     atggtaacaa ttgctttggg tagtagaaat cctgtaaaaa tcaatgctac taaggaggca        60
     ctagatgttt taaagttgaa ttgggatttg ataggaattg aagttgatag tggggtagat       120
     aaacaacctt tttgcgatca gacgtatgtg ggtgctagaa atagggcact gaacgtaata       180
     agggttacga atgcagatat agggttaggg atagaaggag gagtttgtaa cgtctatggt       240
     aaatttatag caaatgctgt ggtatatgtt ataactaaag aaggtttaga gaattttgca       300
     atttcttcat cttttacctt gcctagttct atggtttctt taatacttca aggaaaggaa       360
     ctgggtgaag catcagatat tatttttaaa actaataata gtaagactaa agaaggtgct       420
     ataggattat taactaacaa tgtaattaat agaaaaatgc tctatgttca acctattgtc       480
     ctcgcattat atccaattta taatacgatg attaataata ctccttttta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page