(data stored in ACNUC7421 zone)

EMBL: CP001402.PE481

CP001402.PE481       Location/Qualifiers
FT   CDS_pept        complement(417631..418278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0487"
FT                   /product="CRISPR locus-related DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41117"
FT                   /db_xref="GOA:C4KDZ4"
FT                   /db_xref="InterPro:IPR010163"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ4"
FT                   /protein_id="ACR41117.1"
FT                   /translation="MEGNTLVFGLGFTSEYIVRSITERGRDNIDEVVLMGVFNIDDFRR
FT                   KQADNALNDVKKFLDIINVKYKWKYINVNKDFAEILYEVANELSGKNNLEFYLIGGMRI
FT                   INFVLYYYAMLAKRFGLNVRVFNYTEDMSKKYELPVEIPRRLTDSEAEILKLFKFENSI
FT                   EISIMADRLQKTLSTISKQVSEMEEEGFLECTKTRPKTCRKTILGRVALTFI"
     gtggaaggga atacactagt atttggatta ggctttacct cagagtacat agttaggagt        60
     ataacggaaa ggggaaggga taacattgat gaggtagttc tcatgggagt gtttaacatt       120
     gacgacttta ggaggaagca agcagataat gcattaaatg acgtgaagaa gtttctagat       180
     attataaacg tgaagtataa gtggaagtac attaacgtta acaaggactt cgcagaaatc       240
     ctctatgaag ttgccaatga attatctggt aaaaataact tggagtttta cttgattggt       300
     gggatgagga taattaactt cgtcttgtac tactacgcaa tgctagctaa aagatttggg       360
     ctaaacgtta gggttttcaa ttatacagag gatatgtcca aaaagtacga attgccagtg       420
     gaaattccta gaaggctaac tgatagtgag gctgagatct tgaaactgtt taagttcgag       480
     aactccattg agattagcat aatggctgat aggcttcaaa aaactttatc aactatttca       540
     aaacaagtta gtgaaatgga agaggaggga tttttggagt gtacaaagac taggcctaaa       600
     acgtgtagaa aaactatttt gggtagggtt gctttgacat ttatataa                    648
//

If you have problems or comments...

PBIL Back to PBIL home page