(data stored in ACNUC7421 zone)

EMBL: CP001402.PE484

CP001402.PE484       Location/Qualifiers
FT   CDS_pept        complement(422020..422448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0490"
FT                   /product="HEPN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41120"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ7"
FT                   /protein_id="ACR41120.1"
FT                   /translation="MNNINLAEGLLQEARIRIAYAELDLKENKDFAFCIRLSQEAVELS
FT                   IKAMLRTLSIEYSKTHDPGKILEANKDRLPEWLRQELNNITYASRWLRAEREPSMYGDE
FT                   IEGIPPNKLYNEDYCVKALEVAKHVFKLAEKLLNEIKK"
     ttgaataata ttaatttggc tgaaggactt ctacaagagg ctagaataag gatagcatac        60
     gcggaacttg atttaaagga aaataaggat ttcgcttttt gcatcagatt atcccaagag       120
     gctgttgaac tttcaataaa agcaatgcta agaactttgt ccattgaata ctctaaaact       180
     cacgatccag gaaagatcct tgaggcaaat aaggatagat taccagaatg gctgaggcag       240
     gaattgaata atataaccta tgcttctagg tggttaagag ccgagagaga accttcgatg       300
     tatggtgatg aaatcgaagg catacctccc aataaactgt ataacgagga ttattgcgtt       360
     aaagcattag aagttgctaa acatgtattt aaactagcag aaaaactact aaatgagatt       420
     aagaaataa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page