(data stored in ACNUC7421 zone)

EMBL: CP001402.PE488

CP001402.PE488       Location/Qualifiers
FT   CDS_pept        423901..424101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41124"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE01"
FT                   /protein_id="ACR41124.1"
FT                   /translation="MLKPMYYELIGDKLRGRQIRGLIGQLALELKKNGFTEEAKKLKHF
FT                   IVRNRDTLLFLEEKLYWKQIW"
     atgttaaagc ccatgtatta cgagttaatt ggcgataaac taagaggtcg tcagataaga        60
     ggtcttatag gtcagttagc attagaactc aaaaagaacg gatttacaga agaggctaag       120
     aaacttaagc atttcattgt cagaaaccgt gatactctac tcttcctaga ggaaaagtta       180
     tattggaagc agatatggtg a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page