(data stored in ACNUC7421 zone)

EMBL: CP001402.PE489

CP001402.PE489       Location/Qualifiers
FT   CDS_pept        424186..424515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0494"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41125"
FT                   /db_xref="GOA:C4KE02"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE02"
FT                   /protein_id="ACR41125.1"
FT                   /translation="MSSWVKRKFEHLRRWREYAEIIAKASEDIDPNSKAYVFGGVAENR
FT                   VTVLSDIDILIVSEVKESFKFKLEVFKRAFDIYGLPFDAPVELHVTYKEGFNGYLKYSK
FT                   VIEIA"
     gtgtcaagct gggttaaaag aaaattcgaa catttaagga ggtggagaga atacgctgag        60
     attatcgcca aagcttcaga ggatatcgac cctaattcta aagcttatgt atttggtggt       120
     gttgcagaga atagggttac ggttttaagc gatattgaca ttctgattgt ttctgaagta       180
     aaggagagct ttaagtttaa gttagaagta tttaagaggg cttttgatat ttatggactt       240
     ccctttgatg ccccggtcga attacatgtt acttataagg aggggtttaa tggctaccta       300
     aagtattcta aggttataga gatagcttag                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page