(data stored in ACNUC7421 zone)

EMBL: CP001402.PE49

CP001402.PE49        Location/Qualifiers
FT   CDS_pept        complement(41385..42038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40685"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJG5"
FT                   /protein_id="ACR40685.1"
FT                   /translation="MNPLLLGIDGLSYTSFMKCNPRTLFTLFSSTYRGVVLNKKPQFPQ
FT                   TSWMSVLELKDIKDMSAVNLNNEKPRLLKETNAVAINLPITNPTYGKLSLPYDTSVNAE
FT                   EEINKVTQIVLELIEESPVIASITAIDRLLHKDPTEKCKIYSLVDSAVRKILNKVDDFI
FT                   IFSLYGEPKGENEDGNHEDYGVFLATIPRPSEHDTVKLQEIGELFIKLVKKEYY"
     atgaaccctt tattactagg aatagatggg ttaagctata ctagtttcat gaaatgtaat        60
     ccaaggacat tatttacact atttagcagc acttatagag gagttgtttt aaataaaaag       120
     ccacaatttc cgcaaacctc atggatgtca gtattagagc ttaaggatat aaaagatatg       180
     tcagcagtta atttgaataa tgaaaaacct aggcttctta aagaaactaa tgcagtagca       240
     ataaatttgc ctataactaa tccgacttat ggcaaactta gtcttccata tgatacttca       300
     gtaaatgcag aagaggaaat taataaagta acacaaatag ttctagagct aatagaagaa       360
     agtcccgtta tagcatctat aactgctata gataggcttc tacataaaga tcctacggaa       420
     aaatgtaaaa tttattcatt agtagatagt gcggtacgaa agattttaaa caaggttgac       480
     gattttataa tattttcttt atatggcgaa ccaaagggtg agaatgaaga tggaaatcac       540
     gaagattatg gagtattcct agcaacaatt ccaagacctt cagaacacga tactgtcaaa       600
     ctgcaagaga taggcgagtt atttataaaa ctagttaaaa aggagtatta ttaa             654
//

If you have problems or comments...

PBIL Back to PBIL home page