(data stored in ACNUC7421 zone)

EMBL: CP001402.PE492

CP001402.PE492       Location/Qualifiers
FT   CDS_pept        complement(428638..429285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0497"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41128"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE05"
FT                   /protein_id="ACR41128.1"
FT                   /translation="MEKFSVLSIDLFHPDCWTSITDKYEVNVKLLSQSFDNDNFFSSRI
FT                   LILGRDSKGLINEMRASKNVKVIKVYSMDKGAFVADFIYPKRNTISSLLHETNSIVISH
FT                   RIMDGIEKWKIVVNVSSIPKILQSLERTSNLISFKVVKLSELRKLMNKLTDRNMEILKI
FT                   AYERGLFNYPRQCKLTSISNEIGIKQNTLLYHIRKAEKLLLEILLDEYYSLL"
     atggaaaaat tctcagtact gtcaattgac ctttttcatc cagattgttg gacttctata        60
     actgataaat atgaggttaa cgttaagctc ttatcccaga gtttcgataa cgataatttc       120
     ttttcatcaa ggattctaat actaggcagg gattctaagg ggttaatcaa tgagatgcga       180
     gcttctaaaa acgttaaggt aattaaggta tactcaatgg ataagggagc ctttgtagca       240
     gatttcattt accctaaaag gaacacaatc tctagcttac ttcacgaaac gaactctatt       300
     gtaatatccc ataggattat ggacgggatt gaaaagtgga aaattgtcgt caatgtttct       360
     tctataccta agattttaca aagcctagaa agaacttcaa atttaataag ttttaaagta       420
     gttaaattaa gtgaattacg aaaattaatg aacaaattaa ctgatagaaa catggaaata       480
     cttaagatag catacgaaag agggttattt aattacccta ggcagtgtaa gttaacttca       540
     ataagtaatg aaatagggat taagcaaaat acccttttat atcatataag gaaagctgaa       600
     aagttattat tggaaatttt attagatgag tattatagct tattatga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page