(data stored in ACNUC7421 zone)

EMBL: CP001402.PE494

CP001402.PE494       Location/Qualifiers
FT   CDS_pept        430536..431588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0499"
FT                   /product="luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41130"
FT                   /db_xref="GOA:C4KE07"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE07"
FT                   /protein_id="ACR41130.1"
FT                   /translation="MKYSKIDVMDKIKPALFWVVDYYPDLGISKGEYYEQIAREVEYAE
FT                   KLGYRGVWIAEHHFIDYGIVPSAPIYLTYLASRTSRIRLGPAVSTIVFRNPIQVAEEYS
FT                   LLDTLSKGRLNLAVGSGYLKHEFAGFNVPLEIKREIFDEALDIVIRLMRGEKITINGKY
FT                   FKYENIGINVLPLQNPHPPIWIAVLRAEAAYHVGKKGFNLMMIPYATVDKIGDIMPVVN
FT                   SFREGLKESRSEEKELSLSFHTHVANSFHDAVETSKEYLHRYVFSRLYAKRRTLDELYD
FT                   SGLLLLFGSPEDVANQIYKIYKLARPNMLMFLVDYGMKPYDMVIDILTKIREKVAKHLE
FT                   GKGILLDFDN"
     ttgaaatact caaaaataga tgtgatggat aaaataaaac cagcactatt ttgggttgta        60
     gattattacc cagatttggg tatttcaaag ggagaatatt acgaacaaat agctagggaa       120
     gtggaatatg ctgaaaaatt gggatataga ggagtctgga tagcagaaca ccacttcata       180
     gattacggaa tagtcccatc agccccaata tatttaacat atttagcgag tagaacgagc       240
     agaataagat taggaccagc agtctctaca atagtgttca gaaatcccat acaggtagct       300
     gaggaatact cattactaga cactctctct aagggaagat taaatttagc ggtaggtagc       360
     ggatatttaa aacatgagtt tgcaggcttt aacgttcctc ttgaaattaa aagggaaata       420
     ttcgatgaag ccctagacat agttattaga ctaatgagag gtgagaagat tactattaac       480
     gggaagtatt ttaaatacga aaatattgga ataaacgtat tacccttaca aaaccctcat       540
     cctccaatat ggatagcagt acttagagct gaggctgctt accatgtagg gaagaagggg       600
     tttaacttaa tgatgatacc ttatgccaca gtagataaga tcggcgatat aatgccagtt       660
     gtgaattcct tcagagaggg tcttaaagag agtagaagtg aagaaaaaga gctatccctt       720
     tctttccaca cccacgtagc taactcattc catgatgcag ttgagacttc taaagagtat       780
     ctacatagat acgtattctc aagactttac gctaagagaa gaaccctaga tgaattatac       840
     gatagtggac tattattatt attcggcagt ccagaagacg ttgcaaatca gatctacaag       900
     atatataagc tagcgagacc gaatatgctc atgttcctcg tggattacgg aatgaaacca       960
     tacgatatgg ttattgacat tttaactaaa ataagagaaa aagtggctaa acacttagaa      1020
     ggtaaaggaa tcttgttgga ctttgataat taa                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page