(data stored in ACNUC7421 zone)

EMBL: CP001402.PE495

CP001402.PE495       Location/Qualifiers
FT   CDS_pept        432195..432719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41131"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE08"
FT                   /protein_id="ACR41131.1"
FT                   /translation="MPIIVRKVHKKADGSTIWIRVGESPPVIKDGNVIDGGFFIRIGDD
FT                   KSDKIIRLSDQEALDIAYRIIEAYRRHVRIFTKLDELSYEQYKKSKEVVKDEEEDEEEI
FT                   EKIEEKRNLTPDKIEAELIDYLTAEGGETTLDKVREDLGEEYAAYLRTMKNKGIIIEGT
FT                   RVKLGKNFKNT"
     atgccaatta tagtcaggaa ggttcataaa aaggctgatg gtagcactat ttggataaga        60
     gtaggagaat cacccccagt aataaaagat ggaaatgtaa ttgatggtgg gttttttata       120
     agaatcggtg acgataaaag tgataaaata attagattat ctgaccaaga agctttagat       180
     atagcatata gaataataga ggcttatagg aggcatgtta ggattttcac caaactggac       240
     gagctttcat atgaacagta taagaaaagt aaggaagttg taaaagatga agaagaggat       300
     gaagaagaaa ttgaaaagat agaagagaaa aggaatttaa ctccggacaa aattgaggct       360
     gaattgatag attatttaac agctgaagga ggagaaacaa ccttagacaa ggttagagaa       420
     gatttaggag aagaatatgc tgcatactta agaactatga aaaataaggg aataataatt       480
     gagggaacca gagttaaatt aggtaaaaac tttaaaaata cttag                       525
//

If you have problems or comments...

PBIL Back to PBIL home page