(data stored in ACNUC7421 zone)

EMBL: CP001402.PE497

CP001402.PE497       Location/Qualifiers
FT   CDS_pept        complement(433592..433789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41133"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE10"
FT                   /protein_id="ACR41133.1"
FT                   /translation="MLSTLKNKGAKIITSIIPQDDYNRITEKGAFSNKPFGQTSSIVLA
FT                   NIATWVLSTHVAIRGRDSPI"
     ttgttgtcca cactcaagaa taagggagct aaaataataa cttcaataat cccacaagat        60
     gattacaata gaatcacaga aaagggggcg ttcagtaata aacctttcgg tcaaacttca       120
     agcatagtat tagctaacat tgccacgtgg gtcctttcaa cccacgtggc gattcggggg       180
     agggattcac ctatttag                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page