(data stored in ACNUC7421 zone)

EMBL: CP001402.PE498

CP001402.PE498       Location/Qualifiers
FT   CDS_pept        complement(434084..434245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41134"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE11"
FT                   /protein_id="ACR41134.1"
FT                   /translation="MRVITTSNAEAKKAWKMLRLMFVCCIQDKFPKVEISEHPLDIEDI
FT                   YTEDDLRS"
     gtgagagtaa taactacatc taatgcagaa gcaaagaagg catggaaaat gctaagactt        60
     atgtttgtat gttgtattca agacaaattt cctaaagtag aaattagtga acatccactt       120
     gatattgaag atatttacac tgaggatgac ttaaggagtt ag                          162
//

If you have problems or comments...

PBIL Back to PBIL home page