(data stored in ACNUC7421 zone)

EMBL: CP001402.PE499

CP001402.PE499       Location/Qualifiers
FT   CDS_pept        complement(434372..434875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41135"
FT                   /db_xref="GOA:C4KE12"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE12"
FT                   /protein_id="ACR41135.1"
FT                   /translation="MAIGKTVLIVGVIILIVGIALFFIGGYLTSSGLIKVINSISTATP
FT                   TTLQPGTSQDLGVPTKLSILLYNTSSGQVLKILQEINGTNQSVPQIAEKGYIIALLSPK
FT                   YDTIMVNNLTTPISVKYVLSQELASSLVNVALYTGLGFFLAIIGVIVLLVGLVLFLRGR
FT                   GKKQ"
     atggctatag gtaaaacagt tctgatagta ggggtaataa tactaatagt tggcattgca        60
     ctgttcttta ttggaggata tttaacatca tctggactca ttaaagtgat taactcaata       120
     agtacagcaa ctccaactac tttacaaccg gggacatcac aagatttagg tgtccccact       180
     aagttgtcta tattgctgta caatacgagc tctggacaag tgttaaagat attacaagaa       240
     ataaatggga cgaaccaatc agtaccacaa attgcagaaa agggatatat aatagcgtta       300
     ttaagtccta aatacgatac tataatggta aataacctca ctactccgat ttcagtgaaa       360
     tacgttttaa gtcaagaatt agcgtcttca ttggtaaacg ttgcattata tactggcctt       420
     ggtttctttc tagctattat tggtgtaatc gtgttgctag ttggtttagt attattcctc       480
     agaggtagag gtaaaaaaca gtaa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page