(data stored in ACNUC7421 zone)

EMBL: CP001402.PE506

CP001402.PE506       Location/Qualifiers
FT   CDS_pept        441575..442060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41142"
FT                   /db_xref="GOA:C4KE19"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE19"
FT                   /protein_id="ACR41142.1"
FT                   /translation="MNVIFDVLNEIHGFFGALWAGAALLNFLIRPQEKRQFERIGKFFL
FT                   ITSIITIITGIVIFAYIYLAPYQGNLFLVAAILRSSLDIRIRVFLNLVGGAFGLLAFGA
FT                   GIVISNRIRLMTRFKEGDARVLELRKSVSNLSKISLIFLLLSLAMMILAGSIAQVIT"
     atgaatgtaa ttttcgatgt attaaacgag atccatgggt tttttggtgc actgtgggca        60
     ggagcagcac tacttaactt cttaattaga cctcaggaaa agaggcaatt tgagaggata       120
     gggaaattct ttctgataac gtcaattatt acaataataa ctgggatagt aatttttgcc       180
     tatatttacc tagcccctta tcaagggaat ctattcctag tcgctgcaat tctacgttca       240
     agtttagata ttaggataag ggtcttccta aacttagtag gaggagcttt tgggttattg       300
     gcgtttgggg cagggattgt tataagcaat aggataagac ttatgacacg ttttaaggag       360
     ggagatgcca gggtattgga attaagaaag agcgtaagca acttatctaa aataagcttg       420
     atcttcttac tcctctcatt ggcaatgatg atactagctg gttcaatagc acaagttata       480
     acgtag                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page