(data stored in ACNUC7421 zone)

EMBL: CP001402.PE508

CP001402.PE508       Location/Qualifiers
FT   CDS_pept        443934..446090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0513"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41144"
FT                   /db_xref="GOA:C4KE21"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE21"
FT                   /protein_id="ACR41144.1"
FT                   /translation="MSVFFRTRDRPLRPGDPYPLGSNWIEDEDGVNFSLFSENAEKVEL
FT                   LLYSQTNQKYPKEIIEVKNRTGDLWHILVPGLRPGQLYAYKVYGPYKPALGLRFNPNKV
FT                   LIDPYAKAINGNVIWNDAVFGYKIGDQNQDLSYDERDSSEYVPKSVVINPYFEWDDEDF
FT                   IKRNKVPLKDTVIYEVHVKGFTKLRLDLPENIRGSYEGLASEQMISYLKDLGITTVELM
FT                   PVFHFIGQRFLIDKGLTNYWGYDPINFFSPECRYSSSGCLGEQVFSFKKMVNELHNAGI
FT                   EVIIDVVYNHTAEGNHLGPTLSFRGIDNIAYYMLQPDNKRYYLDFTGTGNTLNLSHPRV
FT                   IQMVLDSLRYWVTDMHVDGFRFDLAAALARELYSVNMLNTFFIALQQDPILSRVKLIAE
FT                   PWDVGQGGYQVGNFPHQWAEWNGKYRDSIRRFWRGEALPYSEIANRLLGSPDIYLGNNK
FT                   TPFASINYVTSHDGFTLEDLVSYNQKHNEANGFNNQDGMNENYSWNCGAEGTINDQNVI
FT                   MCREKQKRNFMITLLISQGTPMILGGDELSRTQRGNNNAFCQDNEITWFDWNLDERKSK
FT                   FLEFVKKMIQFYKAHPVFRRERYFQGKKLFGMPLKDVTFYTPDGKEVDEKTWNSPTQTV
FT                   IFVLEGSVMDEINIYGERIADDSFLIILNANPNNVKVKFQKGKWELVVCSYLREIKPEE
FT                   RIVEGEKELEIEGRTALVYRRIEL"
     atgtcagtat tcttcagaac tagggataga cctctacgtc ctggagatcc atatccatta        60
     ggttcaaatt ggatagaaga tgaggatgga gtaaattttt ccttattctc agagaatgca       120
     gaaaaagttg aattactcct ttattcacaa acaaatcaaa agtatccaaa ggagataata       180
     gaggttaaaa acagaacggg agatctttgg catatattag tcccagggct gagacccggg       240
     caactttacg catacaaggt ttatggtccg tataaaccgg cgttaggatt gagatttaat       300
     cctaataagg ttttaataga cccttacgcc aaagccataa atggtaatgt gatttggaac       360
     gatgcagtat ttggttataa gataggagac caaaatcaag atttaagcta tgacgagagg       420
     gattccagcg aatatgtacc taaaagtgtt gtgattaacc catactttga atgggacgat       480
     gaggatttca ttaagaggaa taaggttcca ttaaaggata cagtaattta tgaagttcac       540
     gtaaaaggat ttacaaaact tagattggat ttgccagaaa acataagggg atcttatgaa       600
     ggtttagcct cagaacaaat gattagctat ctcaaagatt tagggattac tactgtagaa       660
     ttaatgccgg tttttcactt cattggtcaa agatttctga tagataaggg gctaacaaat       720
     tactggggat atgacccaat aaacttcttc tccccggaat gtagatattc cagtagcggc       780
     tgtttaggag aacaagtatt cagtttcaag aaaatggtaa acgaattgca taacgcagga       840
     atcgaggtta taattgatgt agtttataat catactgctg agggaaatca tttaggacca       900
     acgttaagtt tcagaggtat tgataatata gcatattata tgctccaacc agacaataaa       960
     agatattatt tagactttac cggaactggc aacacgttaa atcttagcca tccaagagtt      1020
     atccagatgg tcctagatag cttaagatat tgggttactg atatgcacgt agatggcttt      1080
     agatttgact tagcagccgc tttagctagg gaattgtaca gcgttaatat gttaaatacg      1140
     ttcttcattg cattacagca agatccaata ttgtcacgag taaaactaat agctgaaccg      1200
     tgggatgtag gacaaggagg atatcaagtt gggaatttcc cacatcaatg ggcagaatgg      1260
     aatggaaaat atagggattc tataaggaga ttttggagag gagaagcgtt accctatagc      1320
     gagattgcta acaggctatt aggttcacca gacatctact taggtaataa taaaacacca      1380
     tttgccagta taaactacgt aacttcgcac gatggtttca cattagaaga tttagttagt      1440
     tataatcaaa aacataatga ggcgaatgga tttaacaatc aagatggaat gaacgagaac      1500
     tacagttgga attgtggtgc agaaggaact ataaatgacc aaaacgtaat tatgtgcaga      1560
     gagaaacaga aaaggaactt catgataacg ttacttatta gccaaggaac tcccatgata      1620
     ttaggaggag atgagttaag taggacacaa agaggtaata ataacgcgtt ttgccaagac      1680
     aatgagataa cttggtttga ttggaattta gatgagagaa aatcaaaatt tttagagttt      1740
     gttaaaaaaa tgatccaatt ttataaagcg catccggtat tcagaaggga aagatatttt      1800
     caaggaaaga aattattcgg catgccatta aaagatgtaa cattttacac tccagacggt      1860
     aaggaggttg atgagaaaac gtggaattcc ccaacgcaaa ctgttatctt cgtgttagag      1920
     gggagcgtaa tggatgagat taacatctac ggagagagaa ttgcagatga ttcattctta      1980
     ataatactta acgcaaatcc caataacgta aaagtgaagt ttcaaaaagg taaatgggaa      2040
     ctagttgttt gttcttattt aagagagata aaaccagaag aaagaattgt agaaggtgag      2100
     aaggaattgg aaattgaggg aagaactgca ttagtttata ggaggataga actatga         2157
//

If you have problems or comments...

PBIL Back to PBIL home page