(data stored in ACNUC7421 zone)

EMBL: CP001402.PE513

CP001402.PE513       Location/Qualifiers
FT   CDS_pept        453840..454190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41149"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF2"
FT                   /protein_id="ACR41149.1"
FT                   /translation="MLKAQAIDLVEFSEAYTSSINPLDDKKLKKGKQFKEMVVKVFNPY
FT                   LMMDTAHESGGIKVFEVTARYLESDEVLLERDSIAPLNLVKKVDGRVVVFPSTSPKELR
FT                   VKVYDPLRGRSI"
     atgttaaagg ctcaagcaat agaccttgtt gagttttctg aggcttacac ttcctccatt        60
     aatccccttg atgataagaa gttgaagaag ggtaagcagt tcaaggagat ggtagtcaag       120
     gtttttaacc cctacttgat gatggacact gctcacgaga gtgggggtat taaagtattc       180
     gaggtaactg ctagatattt ggagagtgat gaagttttgt tagaaaggga ttcaattgct       240
     ccccttaatc ttgtaaagaa ggtggatggg agggtagtcg tgtttccctc gactagcccc       300
     aaggaattaa gagtgaaggt ttatgatccc ttaagggggc gttctatata g                351
//

If you have problems or comments...

PBIL Back to PBIL home page