(data stored in ACNUC7421 zone)

EMBL: CP001402.PE514

CP001402.PE514       Location/Qualifiers
FT   CDS_pept        454298..454585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41150"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF3"
FT                   /protein_id="ACR41150.1"
FT                   /translation="MKLQVNGNYIYITLWDKQAKKPRRFYLGRKEDFKKLEELFRVARE
FT                   YRITKQEITDYLEYYFDKRINLTKIEYVILSLSLGVELWKLNGNIRMRLE"
     atgaagttac aagttaatgg taattacatt tacataacac tttgggataa acaagcaaag        60
     aagcctagga gattttatct tgggagaaaa gaggatttta aaaaattgga agaattgttt       120
     cgagtagcta gagaatatag aataactaag caagaaatta ctgattattt agaatattat       180
     tttgacaaga ggataaattt aactaagata gaatatgtca ttctctcctt gagtctgggt       240
     gtagagcttt ggaaattgaa tggaaatata agaatgcgtt tagaatag                    288
//

If you have problems or comments...

PBIL Back to PBIL home page