(data stored in ACNUC7421 zone)

EMBL: CP001402.PE515

CP001402.PE515       Location/Qualifiers
FT   CDS_pept        454546..455094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41151"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF4"
FT                   /protein_id="ACR41151.1"
FT                   /translation="MEIEWKYKNAFRIAIKEIRRFYPEFAIIGRFARNFYANPETTLDI
FT                   DFIANLDDVERLAEFIEHISSHYEIFPNDVGHWQYKIIIKGVRVDLVKPPQYKFDDEVI
FT                   SRRRIVRIEGVGEVPILSPEDLVTLYVVASINRGVKDLIKAKDIIIYSLARHDFNEDYF
FT                   LRKCEENSVKALCLTLLSN"
     ttggaaattg aatggaaata taagaatgcg tttagaatag caattaaaga gataagaagg        60
     ttttatccag aatttgctat aataggaaga tttgcaagaa acttttacgc taatcctgaa       120
     actaccctcg atatagattt tatagcgaat ttagatgatg tcgaaagatt ggcagaattc       180
     atagaacata tatcatctca ttatgaaata tttcctaatg acgtaggaca ttggcaatat       240
     aagataatta ttaaaggtgt aagggttgat cttgtaaaac cacctcaata taagttcgat       300
     gacgaggtaa tatcgaggag aagaatagta agaattgaag gagtgggcga ggttccaata       360
     ttatctccgg aagatttagt aactctttat gtagtagcgt ctataaatag gggagttaaa       420
     gatctgatta aggctaaaga tataattatc tattctttag caagacacga ctttaatgaa       480
     gattatttcc tgaggaaatg tgaagaaaat agcgtaaagg cgttatgttt gactctcctc       540
     tctaactaa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page