(data stored in ACNUC7421 zone)

EMBL: CP001402.PE516

CP001402.PE516       Location/Qualifiers
FT   CDS_pept        455508..456314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0521"
FT                   /product="Protein of unknown function DUF973"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41152"
FT                   /db_xref="GOA:C4KEF5"
FT                   /db_xref="InterPro:IPR009321"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF5"
FT                   /protein_id="ACR41152.1"
FT                   /translation="MESSIQALKNIKTGSLYYFLAIIIALVTEAVIFREKSLANSFFVL
FT                   IFELVVYGILLIGFSRMRTGFFQLSKTINTYIGTTGVNIFIIGIVALLFGAILPILIYI
FT                   GGSLVFIGDVMIGYTIYKIGQRFQVNTEKIAGILVMISITSFIGYIISYFASDEVMRKM
FT                   LQAPREEKLLIVPSDKSIGYGILKSNGDANVVVYSKESSEIISAQIMGYNFQTLQINPK
FT                   TVMAGENRIYIKFALSGVMFVPGNIYNLEILLANNEKLLASLVYEL"
     atggaatcaa gtattcaagc tttgaaaaac attaaaacag gttcactata ttacttttta        60
     gcaataatta tagctttggt aacagaagca gttatattta gagaaaaatc actggctaat       120
     agctttttcg tcttaatatt tgagttagtc gtatatggca tattgctaat aggattttca       180
     agaatgagaa ctggattttt ccagttatcg aaaacgataa atacatacat aggcacaact       240
     ggagttaaca tatttattat cggcatagta gcattgctat tcggtgctat tctaccgatt       300
     ttaatttata taggaggttc cctagtattt ataggtgacg taatgatagg ttatactata       360
     tataagatag gacagagatt tcaagtaaat acagagaaaa ttgcaggaat tctggtaatg       420
     atatctataa cctctttcat aggttacata atttcctact ttgcttctga tgaagttatg       480
     agaaaaatgc ttcaagcccc tagggaagaa aagctactaa tagttcctag cgataagagt       540
     ataggttacg gaattttaaa aagcaacgga gatgcaaatg tagtcgttta ttctaaagag       600
     tcctctgaaa taatctcagc ccaaattatg ggctacaatt ttcagacatt acaaatcaat       660
     cccaaaacag ttatggcggg agaaaataga atatatataa aatttgctct atctggagta       720
     atgtttgttc cgggaaatat ttataattta gagatattac ttgctaataa tgaaaaatta       780
     ttagcctcct tagtttatga gttataa                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page