(data stored in ACNUC7421 zone)

EMBL: CP001402.PE517

CP001402.PE517       Location/Qualifiers
FT   CDS_pept        456498..456866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41153"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF6"
FT                   /protein_id="ACR41153.1"
FT                   /translation="MQKDSLPLNGNIYTISVPRQFLYSGTPVIFANSDFGGSVNPSFAL
FT                   EGTYTHLFKLFNIISLWSTGWDGMFINGQWVTYINAVVGHLSATGVSDMATIPSYLVES
FT                   GLTLFHNEFLGVWTNPYA"
     gtgcagaagg attccttacc tttaaatgga aacatatata cgatttccgt tccacgtcag        60
     ttcttatata gtggtactcc agtaattttc gccaatagcg attttggcgg atcagttaat       120
     ccctcttttg ctcttgaagg aacttacact catctattca aattatttaa tataatatca       180
     ttatggtcaa ctggttggga tggcatgttc attaacggtc aatgggttac gtatattaat       240
     gcagttgttg ggcatttgtc ggcaaccggc gtgagcgata tggcaactat accatcatat       300
     cttgtcgaaa gcggtttaac attgttccat aatgagtttc ttggtgtttg gacgaaccca       360
     tatgcatga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page