(data stored in ACNUC7421 zone)

EMBL: CP001402.PE518

CP001402.PE518       Location/Qualifiers
FT   CDS_pept        complement(458244..458579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0523"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41154"
FT                   /db_xref="GOA:C4KEF7"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF7"
FT                   /protein_id="ACR41154.1"
FT                   /translation="MKLGVRGLWLIIVICNTIDLLYSYELWTGYIAITGGFIELNPLVN
FT                   LIETIGGNYVFPDSISLKIIGLAAMYWTTKFLPYRLKMLALKVVASIFLVVVIYELFIL
FT                   PLLSMAL"
     atgaagttag gggtaagggg tctttggtta attatcgtta tttgtaacac tattgacctc        60
     ctttacagct acgagctatg gactggttat atcgcaataa ctggagggtt tattgaacta       120
     aaccctttgg ttaacttaat tgagaccatc ggaggtaatt acgtgtttcc agactcaatt       180
     agcctcaaaa ttataggatt agccgctatg tattggacaa caaaattttt gccataccgt       240
     ttgaaaatgt tagcgcttaa agtagttgca tcaatcttct tagttgttgt aatatatgaa       300
     ttattcattt tacctttact gtctatggcc ctttaa                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page