(data stored in ACNUC7421 zone)

EMBL: CP001402.PE519

CP001402.PE519       Location/Qualifiers
FT   CDS_pept        complement(458589..458855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0524"
FT                   /product="zinc finger C2H2-type domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41155"
FT                   /db_xref="GOA:C4KEF8"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF8"
FT                   /protein_id="ACR41155.1"
FT                   /translation="MQYSAGLDLNLEDKPFIKSFNFLSLNEVGIIGPYVCPLCLMPFSS
FT                   SVSLKQHIRYTEHAKTCPIFKKEFRNTDSTLDHVCKKHNICVS"
     ttgcaatatt cggctgggtt agacctaaat ttagaagata agccctttat aaagtcattc        60
     aattttttat cgcttaatga agtgggaatt ataggccctt acgtctgtcc cctttgctta       120
     atgccatttt cttcatcagt tagtctgaag caacacatac gatacaccga gcatgcaaag       180
     acttgtccca tattcaaaaa ggagtttaga aacactgatt caaccttaga ccatgtttgc       240
     aaaaaacata atatctgcgt tagttag                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page