(data stored in ACNUC7421 zone)

EMBL: CP001402.PE52

CP001402.PE52        Location/Qualifiers
FT   CDS_pept        43419..44132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0052"
FT                   /product="Protein of unknown function DUF516"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40688"
FT                   /db_xref="GOA:C4KJG8"
FT                   /db_xref="InterPro:IPR007508"
FT                   /db_xref="InterPro:IPR018033"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KJG8"
FT                   /protein_id="ACR40688.1"
FT                   /translation="MDIKLVYSTSDPVGLTIKKLGYSFEEIDEDVTDFHYKNGEAIVIF
FT                   SRHESKASIPSLTVHYPGNPSEEVMGGEPKKLGIAYPRLLTSILREIKKIDLDIEKTME
FT                   ATHHGPTYQNVPVIFVEIGSDKTYWTNERIVRTLVDSTLKGIDKVDETDCRDYISGFGG
FT                   PHYSKLFTKLADESCIGHVISKHYVDKLDDKVIIQAIANSVNNINKVVIDSLNLKQRER
FT                   IIAALKSFDIHIQLR"
     atggacatta agctagttta ctctacttca gatccagtgg gtttgacgat aaaaaaactt        60
     ggatatagtt tcgaagagat tgatgaagat gtaacagatt ttcactacaa gaatggtgag       120
     gctatagtaa ttttttctag gcatgaaagt aaggcaagca ttccctcact aacagtacat       180
     tatcctggta atccatctga agaagttatg ggtggagagc ctaaaaaact cggaatagct       240
     tatcctaggt tacttacttc gattttaaga gaaattaaaa aaatagatct agatatagag       300
     aaaactatgg aggctactca tcatggccct acatatcaaa acgttccagt aatattcgta       360
     gagattggta gtgacaagac gtattggact aacgagagaa tagtcagaac tttagttgat       420
     tcaactctaa aaggtattga taaggttgac gagacagatt gtagagatta catttcaggt       480
     ttcggtggac cccactattc taagcttttt actaagttag ctgacgagag ttgtataggc       540
     catgtgattt ctaagcatta tgttgataag ttggatgaca aggttataat tcaagctata       600
     gccaattctg tgaataatat taataaagtc gttatcgata gcttaaactt aaagcagaga       660
     gaacgaatta tagcggctct aaaaagcttt gatattcata ttcagcttag atag             714
//

If you have problems or comments...

PBIL Back to PBIL home page