(data stored in ACNUC7421 zone)

EMBL: CP001402.PE520

CP001402.PE520       Location/Qualifiers
FT   CDS_pept        complement(458815..459144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41156"
FT                   /db_xref="GOA:C4KEF9"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF9"
FT                   /protein_id="ACR41156.1"
FT                   /translation="MKKLFAVVGSFFSGLGIWFKSIDKATPAIKIIVDNGTLVKIFPIQ
FT                   SVATQSVDGIANISPPIPFSSSLTSYYTEIPPPWYANLWPEVLAVGIVMLGIAIFGWVR
FT                   PKFRR"
     atgaaaaaac tgtttgcagt tgtaggttcc tttttttctg gtttggggat ttggtttaag        60
     tcaatagata aagcaactcc agcaataaaa ataatagtag ataacggaac gttagtcaaa       120
     atatttccaa ttcagtcagt agctactcag tcagtagatg gaatcgccaa tatttcacct       180
     cctataccct tttcgtcatc tttgacctca tactacacag aaatcccacc accttggtat       240
     gctaacctat ggccggaagt cttggcagtg ggtatagtaa tgctgggaat tgcaatattc       300
     ggctgggtta gacctaaatt tagaagataa                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page