(data stored in ACNUC7421 zone)

EMBL: CP001402.PE521

CP001402.PE521       Location/Qualifiers
FT   CDS_pept        complement(459183..460055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41157"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEG0"
FT                   /protein_id="ACR41157.1"
FT                   /translation="MRKSLLALLTLSLALLSLLITPTMALNSGGSQIPIYLTSVYTSSI
FT                   LQGLGFSFNNSNNWVETNYISITINLPSSPPNSYQINNAYSIIAGLSPYPVSNINIFNN
FT                   LLQAYVELFTSPPYTYPNEIGFVVSYGSTTFYSYTTLYSSFAGTQLTITISYTGNGFYV
FT                   QFSDSNGFSHSVSVSSVNFVPYGALILGSLVPNGNYYYFPIGNMLPNASVNFSYTISSF
FT                   TIQGNPATSVGMATISPQYGTPIYVSSTGWFKWVSGSPTLINPTAYTYTNLARIGGSMQ
FT                   ISYTTSQLY"
     atgaggaagt cccttctagc ccttctaacc ctatccctag ccttactatc gcttttaata        60
     actccaacga tggcattaaa ctccggaggt tcgcaaatac cgatatattt aactagtgtt       120
     tatacttcta gtatactaca agggttaggc ttcagtttca ataatagcaa taattgggta       180
     gagacgaatt atatctcgat aactataaac ttacctagtt caccaccaaa tagctatcaa       240
     atcaataacg cctattctat catagccggt ctatcaccat atccagttag taatataaat       300
     atttttaata acctattaca agcctatgtt gaactattca caagcccgcc atatacatat       360
     ccaaatgaaa taggatttgt agttagttac ggttcaacca cattttatag ttacactaca       420
     ctgtatagca gttttgcggg cacacagtta acaataacta tatcatatac tggaaatggt       480
     ttttacgtac aattctctga cagtaacgga ttctctcact cagtttcggt aagttcggtg       540
     aactttgtac catatggtgc tctaatactc gggtcgctag ttccgaacgg aaactattac       600
     tatttcccaa taggcaatat gttacctaac gcttcagtga acttctcgta taccatctca       660
     agtttcacaa tacaagggaa cccggccaca tctgtcggta tggctacaat aagcccacaa       720
     tacgggactc caatatatgt ttcaagcact ggttggttca aatgggtatc cggtagtccg       780
     acgctcataa accctaccgc ctacacctat accaatttgg ctagaatagg aggaagtatg       840
     caaataagtt atacaacgtc gcaactatat taa                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page