(data stored in ACNUC7421 zone)

EMBL: CP001402.PE522

CP001402.PE522       Location/Qualifiers
FT   CDS_pept        complement(460099..460446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0527"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41158"
FT                   /db_xref="GOA:C4KEG1"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEG1"
FT                   /protein_id="ACR41158.1"
FT                   /translation="MNNFLKVTFLFPLMKKLIVGTLIIVLVLLGISFYLHSIDHSATVI
FT                   VTKFPYTVTSNMSSIQTNNSVIPFLGPMFAGNITETSYIPPPSYANLWPETLAVSVALL
FT                   ALTIFLLIRRK"
     gtgaataact ttttaaaggt aacctttctt tttcctttaa tgaagaaatt aattgtgggt        60
     acattaataa tagtcctagt tcttctcggc atatcgtttt atctgcactc aatagaccac       120
     tccgcaacgg ttatagtaac taagtttccg tatacagtaa catcaaatat gtcttcaata       180
     cagacaaaca attctgtgat accatttcta ggtcctatgt ttgcgggcaa tattaccgaa       240
     accagttata tcccaccgcc ttcctatgca aacctatggc ccgaaacatt agccgtcagt       300
     gttgcattat tagcactaac aatcttcctt ctcattagac gaaaatag                    348
//

If you have problems or comments...

PBIL Back to PBIL home page