(data stored in ACNUC7421 zone)

EMBL: CP001402.PE523

CP001402.PE523       Location/Qualifiers
FT   CDS_pept        complement(460501..460836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41159"
FT                   /db_xref="GOA:C4KEG2"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEG2"
FT                   /protein_id="ACR41159.1"
FT                   /translation="MEFLSLLIFVSGIIVAFLTLYFSPDFGRVKPNKRSLSTIFLSIAL
FT                   TGIGLWLYSIDHPTYIAQPYEGSPEGIYFGPSPTIHVPPPWYANLWPFIIAIGLSILII
FT                   PMIRPKN"
     atggaattcc tttcgcttct aattttcgtt tccggaataa tcgtggcttt cttaactctt        60
     tatttctcac cggattttgg aagggtaaaa ccaaataaaa gaagcctatc gaccatattt       120
     ttatcaatag cccttacggg aataggttta tggctctatt ccatcgacca tccaacatat       180
     atagcacaac cttatgaagg atcgccagaa gggatttatt ttgggccgtc acctactata       240
     catgttcccc caccatggta cgctaactta tggccattca taatcgcaat aggcttaagt       300
     atacttataa ttccaatgat tagacccaaa aattag                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page