(data stored in ACNUC7421 zone)

EMBL: CP001402.PE524

CP001402.PE524       Location/Qualifiers
FT   CDS_pept        complement(460870..461166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0529"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41160"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEG3"
FT                   /protein_id="ACR41160.1"
FT                   /translation="MWINGAPEPINAVAGHSSATGYLGGTAPIPSYYAESGLTLFHNHN
FT                   VFINYWYNPYAWYFSIGTPQDYSAHGLNYVQLSEGQSYNTINGLNYALYWIPP"
     atgtggatta atggagctcc ggaacccata aatgcagttg cggggcattc ttcggcaacc        60
     ggctacttag gcggtacggc acctatacca tcatattatg cagaatccgg tttaacatta       120
     ttccataacc ataacgtgtt cataaactat tggtataacc cgtatgcatg gtatttcagt       180
     atagggactc cacaagatta tagcgctcat ggattaaact atgttcagtt atctgaaggc       240
     cagagttata atacaataaa cggtctaaat tacgctttgt attggatccc accataa          297
//

If you have problems or comments...

PBIL Back to PBIL home page