(data stored in ACNUC7421 zone)

EMBL: CP001402.PE529

CP001402.PE529       Location/Qualifiers
FT   CDS_pept        complement(463460..464368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41165"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEG8"
FT                   /protein_id="ACR41165.1"
FT                   /translation="MSGKIADEILNNPQLLSALADKIYDKLKDEIVIKKLEETIGNIKA
FT                   LQEEVKRQGEAISSLQNTVNKHTEAITSLQEAVKKQGEAIQSLQEAVKSLQETVNKHTE
FT                   AITSLQEAVKKQGEAIQSLQEAVKSLQETVNKHTEAITSLQEAVKKQGEAIEGLQKAVR
FT                   KLQRAVMKLSVEVGSFTNRAGKGMERTMLKLYKKALELHGVDPKRVVHGMIKDEEGVIE
FT                   KGKVFEVDFYETNDYVYVFEIKNLADKGAYDQIIIRKKLFYTKYKDKKIKIFLVANYVD
FT                   KKVKKKLEEEGVEIIASHIIK"
     atgagtggaa agattgccga tgagatcctt aacaatccac aattactttc agccttagct        60
     gataaaatat atgacaagct taaggatgaa atagttataa agaaattaga agaaacgatt       120
     ggtaacataa aagccttaca agaggaagtt aagagacaag gagaagcaat atcttcgtta       180
     cagaacacgg tgaataagca tacggaagca ataacatcac ttcaagaagc tgtcaaaaag       240
     caaggagagg caattcaatc tctccaagaa gcagtaaagt cattacaaga gacggtgaat       300
     aagcatacgg aagcaataac atcacttcaa gaagctgtca aaaagcaagg agaggcaatt       360
     caatctctcc aagaagcagt aaagtcatta caagagacgg tgaataagca tacggaagca       420
     ataacatcac ttcaagaagc tgtcaaaaag caaggagagg caatcgaagg tctgcagaag       480
     gcagtacgca aattacaaag agccgttatg aaactttcag tagaagtggg aagtttcact       540
     aatagggcgg gaaaaggaat ggaaaggaca atgctaaaac tttataaaaa ggctttagag       600
     ctacacggag ttgatcctaa gagagtagta catggtatga taaaagatga agagggagtg       660
     atagagaaag gcaaggtgtt tgaggttgac ttttacgaaa ccaatgatta cgtttacgta       720
     tttgaaataa agaatttagc agacaaaggg gcttacgatc aaattatcat aaggaaaaag       780
     ttgttctata ctaagtataa ggataagaag ataaaaatat tccttgtagc aaactatgta       840
     gacaaaaagg taaagaagaa gcttgaagag gaaggggtag aaattatagc ttctcacata       900
     ataaaatga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page