(data stored in ACNUC7421 zone)

EMBL: CP001402.PE533

CP001402.PE533       Location/Qualifiers
FT   CDS_pept        471987..473627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0541"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41169"
FT                   /db_xref="GOA:C4KEH2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR034184"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEH2"
FT                   /protein_id="ACR41169.1"
FT                   /translation="MSKGNSPFSYISSAYGKNHFNIDKPLQKILEYFDVKADFSKLGEF
FT                   AGGELYEIAEHVDKRARPIHVMWSVNGERVDEVWIDPSLRAAIKRLIKDFDINKFPYKE
FT                   ENWHKHYASIYLVSDPGIACILTITNQTAYALYKYGSEELKKYVPYLIGDSDELLFGAT
FT                   WFTEIQGGSDLGSNLVEAEFNGKYWLLKGNTKYFASGVGLADLALVSARPMGSKSGAKG
FT                   LSLFLVPKKNNKGEKNFLIRRLKRKSGTNSVPTGEVEFNSSEAYLIGEKEYGIYYITED
FT                   LMVSRLSNAVGALGIARKSFLESYYYSQSRKAFGKALIEHPLIQKDLLEMELMIEGGMV
FT                   VTFKAIDQFQKSWKAMPPFYNEQYHYARLLTHISKHITAEIASQVSRMAMEIHGGIGFL
FT                   EEFPIERLHREALITPIWEGTGNIQALEMLEAMVKKEAHRQLIRDLEGIVNEAKDEIAS
FT                   KTLDFIKDKATTLLTYREYEMQFYSKDLLLTLGHGISVILLSHMGRKLGIERFTMLSKI
FT                   YYERFLMGRSILRDYISEIRELINMEEMK"
     atgagtaagg gtaatagtcc tttctcatat atatctagtg cgtatgggaa aaatcatttt        60
     aatattgata aaccattaca aaagattttg gaatattttg atgtgaaagc agacttctca       120
     aaattaggtg agtttgcagg gggagaatta tatgaaattg cggaacatgt agataagaga       180
     gctagaccca tacacgtaat gtggagcgta aatggggaga gagtagatga agtatggatt       240
     gatccttctc taagggcagc tattaaaagg ctaatcaaag atttcgatat taataaattt       300
     ccatataaag aggaaaattg gcataagcac tacgcttcaa tatatctagt ttctgatcca       360
     ggtatagcat gcatacttac aattaccaat cagaccgcat acgctctcta taaatacggt       420
     agcgaggaac taaagaaata cgttccctat ctaataggag attcagatga gttgcttttc       480
     ggagctacgt ggttcactga gattcaaggt ggaagtgact taggatctaa tttagtggag       540
     gctgaattta acggtaagta ttggctatta aaaggaaata ctaaatattt cgctagcggt       600
     gtcgggttgg ctgatttagc gttagtaagt gctagaccta tgggaagtaa gagtggggct       660
     aaaggccttt ccctattcct agttcctaaa aagaacaata aaggtgaaaa gaattttttg       720
     ataagaagac ttaagagaaa aagtggaaca aatagtgtgc caactggaga ggtggagttt       780
     aacagttcag aggcttatct tataggagaa aaggaatatg ggatatatta cataactgag       840
     gatcttatgg tatcaagatt atccaatgct gtaggggctt taggtatagc gaggaagtct       900
     tttctcgaat cctattatta ttcgcaatcc agaaaagctt ttggtaaggc attaattgaa       960
     catcccctaa ttcagaaaga tttacttgaa atggagctca tgattgaagg aggtatggta      1020
     gtaactttta aggcaataga tcagttccaa aaatcttgga aagctatgcc acctttctac      1080
     aatgagcagt accattatgc gcgtctattg actcatattt ctaagcatat tacagctgaa      1140
     atagcatctc aagtatcaag aatggcaatg gagattcatg gaggaattgg atttctcgaa      1200
     gagtttccta tagaaagact tcacagagaa gcgcttataa ctccaatttg ggaagggact      1260
     ggaaacattc aggctttaga gatgctcgaa gccatggtga agaaggaagc acatagacaa      1320
     ctaataaggg acttggaagg gattgtaaat gaagcaaagg atgagatagc ttccaaaacg      1380
     cttgatttca tcaaagataa ggccaccacg ctcctaactt acagagaata tgagatgcag      1440
     ttttactcaa aagatttact attaacttta gggcatggta tttccgtgat attactatcc      1500
     catatgggcc gtaagttggg tattgagcga ttcacaatgt tgtcgaagat ctactatgag      1560
     agatttctaa tgggtagaag cattctacga gattatatat ctgagatacg tgagctcata      1620
     aatatggaag agatgaaata g                                                1641
//

If you have problems or comments...

PBIL Back to PBIL home page