(data stored in ACNUC7421 zone)

EMBL: CP001402.PE536

CP001402.PE536       Location/Qualifiers
FT   CDS_pept        476972..477514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0544"
FT                   /product="protein of unknown function DUF105"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41172"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEH5"
FT                   /protein_id="ACR41172.1"
FT                   /translation="MEPKIVRFDLGKEYIILTSALYPEGIIRVNQICSIFVDKSYCSGN
FT                   PWGDVINWCPSKSAIIFMTAAKNYTFKETDWGKFFISAGIGRSGEDAGCTINIGVFVDK
FT                   GLNINGLVDLIRTVTEAKAGALRDLGYKFTGTVSDAIAVGSLPGNEYFIGPGTELGKKI
FT                   AYDIRNTIVELLFKGDD"
     atggagccaa aaattgttag gtttgatctt ggaaaagagt acataatttt aacttcagct        60
     ttatatccag aaggaataat tagagttaac caaatttgta gtattttcgt tgataaaagt       120
     tattgtagtg gtaacccttg gggagatgta attaactggt gtccctctaa atctgccata       180
     attttcatga ctgctgcaaa gaattacact tttaaagaaa ctgattgggg taaatttttc       240
     atcagtgctg gaattgggag aagcggtgag gatgcaggtt gtactattaa tattggggtg       300
     tttgttgata aagggttaaa cattaatgga ttagttgact taataagaac agtaacagag       360
     gctaaggctg gagctttaag ggatttggga tataagttta cgggtactgt aagtgatgca       420
     attgcagttg gctctttacc tggaaacgaa tatttcatag gcccaggtac tgaattaggc       480
     aaaaagatag cctacgatat tagaaacact attgttgaat tattatttaa aggagacgat       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page