(data stored in ACNUC7421 zone)

EMBL: CP001402.PE539

CP001402.PE539       Location/Qualifiers
FT   CDS_pept        complement(479633..480667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41175"
FT                   /db_xref="GOA:C4KEH8"
FT                   /db_xref="InterPro:IPR014574"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEH8"
FT                   /protein_id="ACR41175.1"
FT                   /translation="MTLLDIIIYVEFTFLFINLFLLPNLQPPDILLGARVTTEFKKNKG
FT                   KDIVNKYRLSLIGLTLLSLLLYYFVSFISVFIYVILFLLNVVYWRRIVIRRRGSLPVAS
FT                   SRYAVIDTKKKESRKWIITFIVAWGILIFILVFGSLVYSSAPKLLPTRVDPTGTTFLVK
FT                   TPLNFYKVEIINAAVLGLLTVMGVFITRTTNVINPAYPDRSYYAFLKFKEEVGIIAGIV
FT                   GVFMSSLYTTISLFMWTIINLSELEVFIIFLISIFFTVIIVYVLRIGIEGARYLRDVIA
FT                   NDNLLNDDKYWKGGIIYINPKDPRIWVPKRNSLGYTLNFGHGISILIILAIVFAVITTI
FT                   ILVK"
     atgacacttt tagatataat catttacgtg gagttcacat ttctctttat caatttattc        60
     ctattaccta acttacaacc tccagatatc ctccttgggg ccagggtaac tacggagttt       120
     aaaaagaata agggcaagga tatagttaat aagtatagat tatccctaat tggtttaacg       180
     ttgctatccc ttttgcttta ttatttcgta agctttattt cagttttcat ttacgttatt       240
     ctctttttat taaacgttgt ttattggagg aggattgtga taagacgtag ggggagtcta       300
     ccggtggctt cttccagata tgctgtaatt gacaccaaaa agaaggaaag tagaaagtgg       360
     ataattactt tcatagtagc gtgggggatc ttgatattta tattggtttt tggatcgcta       420
     gtatactcct ctgcacctaa attacttcct actcgcgttg atcctactgg tacaactttt       480
     cttgttaaga ctccattaaa cttttataag gtcgaaataa ttaatgctgc cgttttaggg       540
     ttattaacag tgatgggagt cttcattaca agaactacta atgtaattaa cccagcatat       600
     ccagatagaa gctattacgc atttcttaaa tttaaggaag aagtaggaat tattgcaggg       660
     attgttggag tctttatgag ttcactatat actacaatat cgctcttcat gtggacaata       720
     ataaacttaa gcgaacttga agtttttata atctttctca tatctatatt cttcacagtt       780
     atcatagttt acgtgcttag aattggtatt gaaggtgcta gatatctaag agatgtgata       840
     gctaatgata acttacttaa tgacgataaa tattggaagg gaggaataat atatattaac       900
     ccaaaagacc ctagaatatg ggttccaaaa agaaatagtt taggttacac attaaatttc       960
     ggtcatggaa tttcaatttt gattatccta gccatagttt ttgctgtaat aactacaata      1020
     atccttgtca agtga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page