(data stored in ACNUC7421 zone)

EMBL: CP001402.PE541

CP001402.PE541       Location/Qualifiers
FT   CDS_pept        481875..482786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41177"
FT                   /db_xref="GOA:C4KEI0"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI0"
FT                   /protein_id="ACR41177.1"
FT                   /translation="MDIFQLQGLFLVLSAILGYFLHNRLSVRIVSFVNNWINLPLIFLV
FT                   TYLQRGFEVSDAKIFLTSVIYNFLMFAIVLYLTREIESFIRGAVLINSIFMNTINLPFS
FT                   ILLAFRGNYEISATVAVSMATLRLPIAMIIFTYLNKGISVIHNTTNNSIIRTNLSRYLP
FT                   VITFLIGGSLHYVVGSVINVDVVNTINLILILIVLYEFGYQIRRVIGEMRIKDVTSKPY
FT                   MIIYISRILISPILIFLILISLGITSKIIIEQVMVTAIMAPAITNVVWARVYGFGTEII
FT                   VKSTLILTPISTIIAIIFLILY"
     gtggatatat ttcagcttca aggcctcttt ctagtgttgt cagcaatttt agggtatttc        60
     cttcacaata ggttatccgt gagaatagta agttttgtaa acaactggat aaacttacct       120
     ttgatatttc tcgtcacata tcttcagagg ggttttgagg taagtgacgc taagattttc       180
     ctaacctctg taatttataa tttcttaatg tttgcgatag ttttatactt aaccagagaa       240
     atcgaatcat ttattagagg ggctgtttta ataaactcaa tcttcatgaa tacaattaat       300
     ttacctttct caatactcct agcgtttagg gggaattatg aaatctctgc aacggttgca       360
     gtgtcaatgg ctacattaag gctaccgata gcgatgataa tttttacgta tttaaacaag       420
     ggtataagcg tgatacacaa tactacaaat aattcaataa taagaacaaa tctttcaaga       480
     tatctccctg taataacttt tctaataggt ggtagtttac attatgttgt aggctcagtt       540
     ataaacgttg acgtcgttaa tacaataaat ttgattctca tcttaatagt actttatgaa       600
     ttcggttatc aaataagaag agtaattggt gaaatgagga ttaaagatgt tacgtcaaag       660
     ccttacatga taatttatat atcaagaatt cttattagcc caatcctaat atttcttata       720
     ttaatttctc taggtatcac ttccaagata attatcgagc aagttatggt aacagcgatt       780
     atggctccag caataacaaa cgtggtttgg gctagagttt atggttttgg cacagaaatc       840
     atagtgaaat ccaccttaat attaacacct attagtacaa taattgctat aatatttctt       900
     atattatatt aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page