(data stored in ACNUC7421 zone)

EMBL: CP001402.PE542

CP001402.PE542       Location/Qualifiers
FT   CDS_pept        482965..483816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41178"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI1"
FT                   /protein_id="ACR41178.1"
FT                   /translation="MYSTELTLNSPIWIVRKFLMDPLFISGVSGHISILKFKDKQKDEY
FT                   IMGDRIRELSAPTDEFIALYILLRTNKDFKYTEGIFNGPKITMQSIKYSGMSDDGKLEF
FT                   TIEFMPKSLGDTQTRLYVATNVKYNDSLLDKMLGKSAVDFAKHIVEDHFATYARVYFPS
FT                   LYGDIIRSLTNKETDKEKTTQGLSLTPLFEFSGDATSILSKINEMVSQLDLGLIKVNFG
FT                   KVNCNIIVQNKDMKRAICRSDSNVKAGFEALSLIISAKGQGKMEVYSVKMEDLIDTLYT
FT                   LA"
     atgtacagca cagaattgac attaaattcc cctatttgga tcgtgagaaa attccttatg        60
     gatcctctgt ttattagtgg agttagtgga catatttcca ttttaaaatt taaggataaa       120
     caaaaggacg agtatatcat gggagataga attagggaat tatcagcacc cacagacgag       180
     ttcatagctc tgtacatatt attgagaacc aataaagact tcaaatacac tgaggggatt       240
     ttcaatgggc cgaaaattac catgcaaagc ataaaatatt ctggtatgtc tgatgatgga       300
     aaattggagt ttacaataga atttatgcca aaaagtttag gagatactca gacaaggcta       360
     tacgttgcga cgaatgtaaa gtataacgat tcgctattag ataaaatgtt aggaaagtca       420
     gccgttgatt tcgcaaagca tatagtagaa gaccatttcg caacttacgc aagagtatat       480
     ttcccatcat tatatggaga cattattagg agtttaacta ataaagaaac tgataaagaa       540
     aaaacgacac aaggattatc gctaacacca ttatttgagt tcagtggaga tgctactagt       600
     atattaagta agattaacga gatggtatct cagctagatt taggtctcat taaggtaaac       660
     tttggtaaag taaattgtaa cattatagtt caaaataagg acatgaaaag ggcgatttgc       720
     agatccgata gtaatgtaaa agcgggtttt gaggcattat ctctgataat ttccgccaaa       780
     ggacaaggta agatggaagt gtattcagtg aagatggagg atctaattga taccttgtat       840
     acattagctt aa                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page