(data stored in ACNUC7421 zone)

EMBL: CP001402.PE543

CP001402.PE543       Location/Qualifiers
FT   CDS_pept        complement(483904..485403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41179"
FT                   /db_xref="GOA:C4KEI2"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI2"
FT                   /protein_id="ACR41179.1"
FT                   /translation="MRPKMLLLIPILLSLPTLALAANSSSPSLYVMYQQYSSTLQITPS
FT                   HITYKYSSSFYNTTTSSTNDERTIKYNSNSFNVNVGPLTNYTGKVSVNVSPFSISVTSQ
FT                   IPQLARVLLIEPGLIEEVVWAGFTNTTTTVKGLTYFNNTATLVLQFLNGSNFANVTFTI
FT                   SHTQTTYQKALTLLLHKVNLTMTGEYQLTLTIQGTQPQRYSKMEFNYEGIRAQAPYNTS
FT                   IAYYNGTYVPAMIWSSEASGLLATELTKLQGSVEFTDIEFFGVNGSVVGSLDNTFSSIY
FT                   FTHQGFILNITYNSLNSRIKIVINPNAEYAKASVATTVLVNGNPAVVVITDQGVESTAT
FT                   VNLYHKVMVFGPATLIYVNTTSSGAYITIFPNGSYEYVSQVEPSVTVSNITLGGKTYTT
FT                   QIVNINNSSNYVIFNVSMAKNETFAVFKQGSNGMVELNPNNYFIYNGKIVVFDDPSITY
FT                   YIVYGYQPSSQSFSISSNLLLPIIIAIVFIVVVAILALRRR"
     atgagaccta aaatgttact cttaattcct atactccttt ccctaccaac acttgctctt        60
     gctgctaact cttcatcacc ttcactctac gtaatgtatc aacaatattc atcaacactc       120
     cagattaccc catctcatat aacgtacaaa tactcgtcaa gtttttataa cactacaacg       180
     tcctcaacca atgacgagag gacaataaaa tacaatagta actcatttaa tgtaaatgta       240
     ggtcccttaa ctaattatac gggaaaagta agcgtaaatg taagcccgtt cagtataagc       300
     gttacgtcac aaataccgca attagctaga gtgttactaa ttgaaccagg gttaatagaa       360
     gaggtagtat gggctggttt tacaaatact acaaccacgg tgaagggact aacgtatttt       420
     aacaatactg caactctagt attacagttc ctaaacggta gtaatttcgc caatgtaaca       480
     tttacaatat cacacactca aacaacgtat caaaaggcgt taacgctatt attacataag       540
     gttaacttaa cgatgactgg agaatatcag cttactttaa ctatacaagg aacacaaccg       600
     cagaggtata gtaagatgga gttcaattat gaagggataa gggctcaagc accttacaat       660
     acttcaatag cctattataa tgggacctac gttcccgcaa tgatatggag tagtgaagcc       720
     agtggacttt tggctactga gcttactaaa ttacaaggta gtgtggagtt cactgatatt       780
     gaattctttg gtgtaaatgg tagtgttgta ggatctctgg ataatacttt ctcctcaatc       840
     tactttactc atcaaggttt tatattaaac ataacgtata atagtttaaa ttctagaata       900
     aaaattgtta ttaatccaaa tgcagagtac gctaaagcct cagtagctac tactgtctta       960
     gtcaacggaa atcctgcagt tgtagttatt actgatcaag gagtagagag tactgcaact      1020
     gttaacttat accacaaggt tatggtattt ggtccagcaa ccctaattta cgttaatact      1080
     acatccagtg gagcatatat taccatattc cctaatggat cttacgagta tgtaagccaa      1140
     gtagagccta gtgttacagt ttcaaatatt actttaggag gaaaaaccta tactacacag      1200
     atcgttaaca ttaacaatag ttcaaattac gtgatattta acgttagtat ggcaaagaat      1260
     gagacgtttg ccgtttttaa acaaggtagt aatggaatgg ttgaattgaa tccaaataat      1320
     tattttatct ataacggaaa gattgtggtg tttgacgatc cttcaataac ttattacata      1380
     gtatatggat atcaaccatc ttctcagtca tttagtatct ccagtaatct acttcttccc      1440
     ataattattg cgatagtatt tatagtagtt gtagcgatat tagcattaag gagaagataa      1500
//

If you have problems or comments...

PBIL Back to PBIL home page